SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G7P4R6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G7P4R6
Domain Number 1 Region: 261-408
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 6.82e-36
Family Glutathione S-transferase (GST), C-terminal domain 0.00000251
Further Details:      
 
Domain Number 2 Region: 183-258
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000114
Family Glutathione S-transferase (GST), N-terminal domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G7P4R6
Sequence length 412
Comment (tr|G7P4R6|G7P4R6_MACFA) Chloride intracellular channel protein {ECO:0000256|RuleBase:RU362009} KW=Complete proteome; Reference proteome OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN=EGM_13649 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MNDEDYSTIYDTIQNERTYEVPDQPEENESPHYDDVQEYLRPENDLYATQLNAYEYDFVS
VYTINGEETSLASAQSEDRGYLLPDEIYSELQEAQPGELQEDRGISMEGLYSPTQDQQPC
PEGLQENGSVMKEDLPSPSSFTIQHSKAFSISKYSSTCYSDAEGLEEKEGARMNPEICLF
VKAGIDGESIGNCPFSQRLFMILWLKGVVFNVTTVDLKRKPADLHNLAPGTHPPFLTFNG
DVKTDVNKIEEFLEETLTPEKYPKLAAKHRESNTAGIDIFSKFSAYIKNTKQQNNAALER
GLTKALKKLDDYLNTPLPEEIDASTCGEDKGSRRKFLDGDELTLADCNLLPKLHVVKIVA
KKYRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELAYADVAKRLSRS
Download sequence
Identical sequences F7E2U2 G7P4R6
9544.ENSMMUP00000004674 ENSMMUP00000004674 ENSMMUP00000004674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]