SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G7P6F7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G7P6F7
Domain Number 1 Region: 226-487
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 9.03e-97
Family Fibrinogen C-terminal domain-like 0.0000000000661
Further Details:      
 
Domain Number 2 Region: 88-224
Classification Level Classification E-value
Superfamily Fibrinogen coiled-coil and central regions 4.28e-65
Family Fibrinogen coiled-coil and central regions 0.0000156
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G7P6F7
Sequence length 491
Comment (tr|G7P6F7|G7P6F7_MACFA) Fibrinogen beta chain {ECO:0000313|Ensembl:ENSMFAP00000027485} KW=Complete proteome; Reference proteome OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN=EGM_14761 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MKRMVSWSFHKFKTMKHLLLLLLCVFLVKSQGVNGNEESPFSGRGHRPLDKKREEAPSLR
PAPPPISGGGYRARPAKAAASQKKVERKAPDAGGCLHADPDLGVLCPTGCQLQEALLQQE
RPIRSSVDELKNSVQIVSQTSSSTFQYTYLLKDMWQKRQKQVKDNENVVNEYSSDLEKHQ
LYIDETVNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKE
CEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWNPYK
QGFGNIATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFT
VQNEANKYQISVNKYRGTAGNALMDGASQLTGENRTMTIHNGMFFSTYDRDNDGWLTADP
RKQCSKEDGGGWWYNRCHAANPNGRYYWGGKYTWDMAKHGTDDGVVWMNWKGSWYSMKKM
SMKIRPFFPQQ
Download sequence
Identical sequences F6UZ87 G7P6F7
9544.ENSMMUP00000028060 ENSMMUP00000028060 ENSMMUP00000028060 XP_005556177.1.63531 XP_014994859.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]