SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G7P6N2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G7P6N2
Domain Number 1 Region: 57-82,127-168
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000714
Family HLH, helix-loop-helix DNA-binding domain 0.0047
Further Details:      
 
Domain Number 2 Region: 167-210
Classification Level Classification E-value
Superfamily Orange domain-like 0.00000000418
Family Hairy Orange domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G7P6N2
Sequence length 327
Comment (tr|G7P6N2|G7P6N2_MACFA) Helt bHLH transcription factor {ECO:0000313|Ensembl:ENSMFAP00000044260} KW=Complete proteome; Reference proteome OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN=EGM_14860 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MSDKLKERKVSRLSPNGTCALVVEASDSATRHLCGPMAGKCLHGTLSVEESRVRTPVSHK
VIEKRRRDRINRCLNELGKTVPMALAKQGEPQEALAQIRCRARWLVLSRATVPAQQAPGR
CEGPFLLLQSSGKLEKAEILEMTVQYLRALHSADFPRGREKAELLAEFANYFHYGYHECM
KNLVHYLTTVERMETKDTKYARILAFLQSKARLGAEPAFPPLGSLPEPDFSYQLHPAGPE
FAGHSPGEAAVLPQGSGAGPFPWPPGAARSPALPYLPSASVQLASPAQQHSPFLTPVQGL
DRHYLNLIGHAHPNALNLHTPQHPPVL
Download sequence
Identical sequences F6QM82 G7P6N2
ENSMMUP00000001440 ENSMMUP00000001440 NP_001180664.1.72884 9544.ENSMMUP00000001440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]