SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G7P8M1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G7P8M1
Domain Number 1 Region: 32-80
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 7.21e-16
Family Ovomucoid domain III-like 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G7P8M1
Sequence length 80
Comment (tr|G7P8M1|G7P8M1_MACFA) Serine peptidase inhibitor, Kazal type 6 {ECO:0000313|Ensembl:ENSMFAP00000036113} KW=Complete proteome; Reference proteome OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN=EGM_15521 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MKLSGIFLLLSLALFCFLSGVFSQGGRVDCGEFQDPKVYCTRESNPHCGSDGQTYGNKCA
FCKAMVKSGGKISLKHPGKC
Download sequence
Identical sequences A0A096MR35 A0A2K5LGR9 A0A2K5YHC5 A0A2K6DGF0 F7E7E1 G7P8M1
ENSMMUP00000004655 XP_001103616.1.72884 XP_008013093.1.81039 XP_008013094.1.81039 XP_011714388.1.29376 XP_011714389.1.29376 XP_011714390.1.29376 XP_011714391.1.29376 XP_011834475.1.47321 XP_011834485.1.47321 XP_011924082.1.92194 XP_011924083.1.92194 XP_014996687.1.72884 XP_015307591.1.63531 ENSPANP00000002229 ENSMMUP00000004655 9544.ENSMMUP00000004655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]