SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G7PAU5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G7PAU5
Domain Number 1 Region: 277-306
Classification Level Classification E-value
Superfamily TrpR-like 0.0000445
Family SPO1678-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G7PAU5
Sequence length 702
Comment (tr|G7PAU5|G7PAU5_MACFA) Uncharacterized protein {ECO:0000313|EMBL:EHH63765.1} KW=Complete proteome; Reference proteome OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN=EGM_16799 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MTSRNQLVQRVLQELQEAVECEGLEGLVGAALEAKQVLSSFTLPTCREGGPGLQVLEVDS
VALSLYPDDAPRNMLPLVCKGEGSLLFEAASMLLWGDAGLSLELRARTVVEMLLHRHYYL
QGMIDSKVMLQAVRYSLCSEESPEMTSLPPATLEAIFDADVKASCFPSSFSNVWHLYALA
SVLRRNIYSIYPMRNLKIRPYFNRVIRPRRCDHMPSTLHIMWAGQPLTSHFFRHQYFAPV
VGLEEVEAEGAPGMAPALPTLAPLSSPAKTLELLNREPGLSYSHLCERYSVTKSTFYRWR
RQSQEHRQRVAARFSAKHFLQDSFHRGGVVPLQQFLQRFPEISRSTYYAWKHELLGSGTC
PALPPKEVLGMEELEKLPEEQVAEEELECSALAVSSPGMVLMQRAKLYLEHCISLNTLVP
YRCFKRRFPGISRSTYYNWRRKALRRNPSFKPAPALSAPGTPQPASVGEGAVIPWKSEAE
EGAGKATDEEPPTPQELLPLRMPLSRWQRRLRRAARRQVLSGHLPFCRFRLRYPSLSPSA
FWVWKSLARGWPRGLSKLQVPAPTLGKGGQEAEEKQEEEAGRDVTTVMAPPVRASSEDAE
GGPSREGALQEGATAQGQPHSGPLLSQPVVAAAGGRDGRMLVMDMIATTKFKAQAKLFLQ
KRFQSKSFPSYKEFSALFPLTARSTYYMWKRALYDGLTLVDG
Download sequence
Identical sequences A0A2K6AM83 F7APM8 G7PAU5
ENSMMUP00000032728 9544.ENSMMUP00000032728 NP_001181827.1.72884 XP_011763888.1.29376 XP_011763889.1.29376 XP_011763890.1.29376 ENSMMUP00000032728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]