SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G7PD02 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G7PD02
Domain Number 1 Region: 51-119
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000204
Family Growth factor receptor domain 0.0059
Further Details:      
 
Domain Number 2 Region: 115-185
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000234
Family VWC domain 0.039
Further Details:      
 
Domain Number 3 Region: 214-259
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000131
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G7PD02
Sequence length 367
Comment (tr|G7PD02|G7PD02_MACFA) WNT1-inducible-signaling pathway protein 1 {ECO:0000313|EMBL:EHH64439.1, ECO:0000313|Ensembl:ENSMFAP00000000359} KW=Complete proteome; Reference proteome OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN=EGM_17642 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MRWFLPWMLAAVTAAATSGVLATALSPAPTTMDFTPAPLEDTSSRPQFCKWPCECPPSPP
RCPLGVSLITDGCECCKMCAQQLGDNCTEAAICDPHRGLYCDYSGDRPRYAIGVCAQVVG
VGCVLDGVRYNNGQSFQPNCKYNCTCIDGAVGCTPLCLRVRPPRLWCLNPRRVSIPGHCC
ERWVCEDDARRPRKTAPRDTGAFDAVGEIEPWHRNCIAYTSPWSPCSTSCGLGVSTRISN
VNAQCWPEQESRLCNLRPCDVDIRTLIKAGKKCLAVYQPEASMNFTLAGCISTRSYQPKY
CGVCRDSRCCIPYKSKTINVSFQCPDGLGFSRQVLWINACFCNLSCRNPNDIFADLESYP
DFSEIAN
Download sequence
Identical sequences A0A2K6DCY7 F6SJ52 G7PD02
ENSMMUP00000013337 ENSMMUP00000031925 9544.ENSMMUP00000013337 XP_001087371.1.72884 XP_005564175.1.63531 XP_011758404.1.29376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]