SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G7PDK9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G7PDK9
Domain Number 1 Region: 483-836
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.59e-113
Family PDEase 0.000000254
Further Details:      
 
Domain Number 2 Region: 55-253
Classification Level Classification E-value
Superfamily GAF domain-like 8.94e-31
Family GAF domain 0.00066
Further Details:      
 
Domain Number 3 Region: 238-283,310-459
Classification Level Classification E-value
Superfamily GAF domain-like 5.49e-30
Family GAF domain 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G7PDK9
Sequence length 858
Comment (tr|G7PDK9|G7PDK9_MACFA) Phosphodiesterase {ECO:0000256|RuleBase:RU363067} KW=Complete proteome; Reference proteome OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN=EGM_18221 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MGEINQDAVEKYLEENPQFAKEYFDRKLRVEVLGEIFKNSQVPVQSSMSFSELTQVEESA
LCLELLWTVQEEGGTPEQGVHRALQRLAHLLQADRCSMFLCRSRNGIPEVASRLLDVTPT
SNFDDNLVGPDKEVVFPLDIGIVGWAAHTKKTHNVPDVKKNSHFSDFMDKQTGYVTKNLL
ATPIVMGKEVLAVIMAVNKVNASEFSKQDEEVFSKYLNFVSVILKLHHTSYMYNIESRRS
QILMWSANKVFEELTDVERQFHKALYTVRTYLNCERYSIGLLDMTKEKEFYDEWPIKLGE
VEPYKGPKTPDGREINFYKIIDYILHGKEEIKVIPTPPADHWTLISGLPTYVAENGFICN
MMNAPADEYFTFQKGPVDETGWVIKNVLSLPIVNKKEDIVGVATFYNRKDGKPFDEHDEY
ITETLTQFLGWSLLNTDTYDKMNKLENRKDIAQEMLMNQTKATPEEIKSILKFQEKLNVD
VIDDCEEKQLVAILKEDLPDPRSAELYEFRFSDFPITEHGLIQCGIRLFFEINVVEKFKV
PVEVLTRWMYTVRKGYRAVTYHNWRHGFNVGQTMFTLLMTGRLKKYYTDLEAFAMLAAAF
CHDIDHRGTNNLYQMKSTSPLARLHGSSILERHHLEYSKTLLQDESLNIFQNLNKRQFET
VIHLFEVAIIATDLALYFKKRTMFQKIVDACEQMQTEEEAIKYVTVDPTKKEIIMAMMMT
ACDLSAITKPWEVQSQVALMVANEFWEQGDLERTVLQQQPIPMMDRNKRDELPKLQVGFI
DFVCTFVYKEFSRFHKEITPMLSGLQNNRVEWKSLADEYDAKMKVIEEEAKKQEEGAEKA
AEDSGGGDDKKSKTCLML
Download sequence
Identical sequences A0A1D5R2R1 G7PDK9
9544.ENSMMUP00000019304 ENSMMUP00000019304 XP_001092604.1.72884 XP_005566032.1.63531 ENSMMUP00000019304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]