SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G7PDL1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G7PDL1
Domain Number 1 Region: 66-207
Classification Level Classification E-value
Superfamily L domain-like 5.83e-35
Family Ngr ectodomain-like 0.0036
Further Details:      
 
Weak hits

Sequence:  G7PDL1
Domain Number - Region: 383-548
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.000698
Family Quinohemoprotein amine dehydrogenase B chain 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G7PDL1
Sequence length 557
Comment (tr|G7PDL1|G7PDL1_MACFA) Leucine rich glioma inactivated 1 {ECO:0000313|Ensembl:ENSMFAP00000032417} KW=Complete proteome; Reference proteome OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN=EGM_18223 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MESERSKRMGNACIPLKRIAYFLCLLSALLLTEGKKPAKPKCPAVCTCTKDNALCENARS
IPRTVPPDVISLSFVRSGFTEISEGSFLFTPSLQLLLFTSNSFDVISDDAFIGLPHLEYL
FIENNNIKSISRHTFRGLKSLIHLSLANNNLQTLPKDIFKGLDSLTNVDLRGNSFNCDCK
LKWLVEWLGHTNATVEDIYCEGPPEYKKRKINSLSSKDFDCIITEFAKSQDLPYQSLSID
TFSYLNDEYVVIAQPFTGKCIFLEWDHVEKTFRNYDNITGTSTVVCKPIVIETQLYVIVA
QLFGGSHIYKRDSFANKFIKIQDIEILKIRKPNDIETFKIENNWYFVVADSSKAGFTTIY
KWNGNGFYSHQSLHAWYRDTDVEYLEIVRTPQTLRTPHLILSSSSQRPVIYQWNKATQLF
TNQTDIPNMEDVYAVKHFSVKGDVYICLTRFIGDSKVMKWGGSSFQDIQRMPSRGSMVFQ
PLQINNYQYAILGSDYSFTQVYNWDAEKAKFVKFQELNVQAPRSFTHVSINKRNFLFASS
FKGNTQIYKHVIVDLSA
Download sequence
Identical sequences A0A0D9R1M8 A0A0S2Z4S7 A0A2I3MHY1 A0A2J8Y5E3 A0A2K5J2L8 A0A2K6A3M4 A0A2K6CQR1 A0A2K6KYD2 A0A2K6NRD3 F7GS70 G1RQZ5 G3QIJ9 G7PDL1 O95970
ENSMMUP00000002429 ENSMMUP00000002429 ENSGGOP00000002210 NP_001247986.1.72884 NP_005088.1.87134 NP_005088.1.92137 XP_003255285.1.23891 XP_004049853.1.27298 XP_005566038.1.63531 XP_007961790.1.81039 XP_010356222.1.97406 XP_011736764.1.29376 XP_011789702.1.43180 XP_011843855.1.47321 XP_017732259.1.44346 9544.ENSMMUP00000002429 9606.ENSP00000360472 ENSP00000360472 ENSP00000360467 ENSGGOP00000002210 ENSP00000360472 ENSNLEP00000015659 ENSPANP00000020666 gi|4826816|ref|NP_005088.1| ENSNLEP00000015659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]