SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G7PFZ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G7PFZ2
Domain Number 1 Region: 92-131
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000385
Family EGF-type module 0.011
Further Details:      
 
Domain Number 2 Region: 16-93
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000222
Family Laminin G-like module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G7PFZ2
Sequence length 132
Comment (tr|G7PFZ2|G7PFZ2_MACFA) Uncharacterized protein {ECO:0000313|EMBL:EHH65937.1} KW=Complete proteome; Reference proteome OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN=EGM_02810 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
PNIGHLGLPHGPSGEKMAVVTVDDCDTTMAVRFGKDVGNYSCAAQGTQTGSKKSLDLTGP
LLLGGVPNLPEDFPVHNRQFVGCMRNLSVDGCAARRNFCDGRRCQNGGTCVNRWNMYLCE
CPLRFGGKNCEQ
Download sequence
Identical sequences G7PFZ2
9544.ENSMMUP00000036909 ENSMMUP00000036909 ENSMMUP00000036909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]