SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G7PL87 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G7PL87
Domain Number 1 Region: 35-152
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000136
Family V set domains (antibody variable domain-like) 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G7PL87
Sequence length 234
Comment (tr|G7PL87|G7PL87_MACFA) Uncharacterized protein {ECO:0000313|EMBL:EHH55096.1, ECO:0000313|Ensembl:ENSMFAP00000034788} KW=Complete proteome; Reference proteome OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN=EGM_04232 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MPCGLSALIMCLKGMVAVVVAVDDGDSQALAGNKILVKQSPMLVAYDNAVNLSCKYSYNL
FSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQ
TDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWALVVVGGVLACY
SLLVTVAFCIFWMRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
Download sequence
Identical sequences G7N8Q2 G7PL87
ENSMMUP00000007905 XP_011716294.1.29376 XP_014966207.1.72884 XP_015287619.1.63531 ENSMMUP00000037834 9544.ENSMMUP00000037834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]