SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G7PM59 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G7PM59
Domain Number 1 Region: 13-114
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 7.48e-20
Family Thyroglobulin type-1 domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G7PM59
Sequence length 289
Comment (tr|G7PM59|G7PM59_MACFA) Uncharacterized protein {ECO:0000313|EMBL:EHH55554.1} KW=Complete proteome; Reference proteome OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN=EGM_04785 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
ECVCENYKLAVNCFLNDNGQCQCTSIGAQNTVLCSKLAAKCLVMKAEMNGSKLGRRAKPE
GALQNNDGLYDPDCDESGLFKAKQCNGTSTCWCVNTAGVRRTDKDTEITCSERVRTYWII
IELKHKAREKPYDVQSLRTALEEAIKTRYQLDPKFITNILYEDNVITIDLVQNSSQKTQN
DVDIADVAYYFEKDVKGESLFHSKKMDLRVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK
AGVIAVIVVVVIAIVAGIVVLVISRKKRMAKYEKAEIKEMGEIHRELNA
Download sequence
Identical sequences G7PM59
9544.ENSMMUP00000016268 ENSMMUP00000016268 ENSMMUP00000016268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]