SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G7PUA0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G7PUA0
Domain Number 1 Region: 26-127
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000863
Family Dystroglycan, N-terminal domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G7PUA0
Sequence length 387
Comment (tr|G7PUA0|G7PUA0_MACFA) Uncharacterized protein {ECO:0000313|EMBL:EHH57949.1} KW=Complete proteome; Reference proteome OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN=EGM_07701 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MAVTLFWTPLLVVLLAGLGDCEAQQTTLYPLVGRVFVHTLDHETFLSLPEHVAVPPAVHI
TYHAHLQGHPDLPRWLRYTQRSPHHPGFLYGSATPEDRGRQVIEVTAYNRDSFDTTQQRL
VLEIGDSEGPLLPYQAEFLVRSHDVEEVLPSAPASRFLSALGGLWEPGELQLLNITSALD
RGGRVPLPIEGRKEGVYIKVGSASPFSTCLKMVASPDSHARCAQGQPPLLSCYDTLAPHF
RIDWCNVTLVDKSVPEPADEMPTPGDGILEHDPFFCPPTEAPDRDFLVDALVTLLVPLLV
ALLLTLLLAYVMCCRREGRLKRDLATSDIQMVHHCTIHGNTEELRQMAANREVPRPLSTL
PMFNVRTGERLPPRVDSAQVPLILDQH
Download sequence
Identical sequences F7H4B7 G7PUA0
ENSMMUP00000034893 ENSMMUP00000001953 XP_001092850.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]