SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G7PWM2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G7PWM2
Domain Number 1 Region: 1-89
Classification Level Classification E-value
Superfamily EF-hand 1.31e-24
Family S100 proteins 0.0000298
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G7PWM2
Sequence length 92
Comment (tr|G7PWM2|G7PWM2_MACFA) S100 calcium-binding protein {ECO:0000256|RuleBase:RU361184} KW=Complete proteome; Reference proteome OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN=EGM_08794 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMET
LDSDGDGECDFQEFMAFVAMVTTACHEFFEHE
Download sequence
Identical sequences A0A096NI64 A0A0D9R407 A0A2K5MVC8 A0A2K5YCR0 A0A2K6CEU0 A0A2K6KKS2 A0A2K6P1S4 F7ANQ9 G7PWM2 W5PVB6
9544.ENSMMUP00000020762 ENSOARP00000014399 ENSMMUP00000020762 ENSMMUP00000020762 ENSPANP00000012662 NP_001247455.1.72884 NP_001270589.1.63531 XP_004003441.1.66739 XP_004264683.1.21590 XP_004331477.1.83887 XP_004416256.1.74151 XP_005548529.1.63531 XP_005675734.1.57651 XP_005983508.1.78601 XP_006750586.1.47382 XP_007452537.1.90284 XP_007969448.1.81039 XP_010368392.1.97406 XP_010368393.1.97406 XP_011724011.1.29376 XP_011724012.1.29376 XP_011852217.1.47321 XP_011852218.1.47321 XP_011852219.1.47321 XP_011892958.1.92194 XP_011892959.1.92194 XP_011892960.1.92194 XP_012026509.1.54773 XP_014988136.1.72884 XP_017702785.1.44346 XP_017702786.1.44346 XP_017702787.1.44346 XP_021534887.1.83697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]