SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G7PX72 from Uniprot 2018_03 genome

(show help)
Strong hits

Sequence:	G7PX72
Domain Number 1	Region: 98-169
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.000000000000119
Family	LIM domain	0.013
Further Details:

Domain Number 2	Region: 36-103
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.000000000000191
Family	LIM domain	0.011
Further Details:

Domain Number 3	Region: 8-34
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.0000452
Family	LIM domain	0.041
Further Details:

Weak hits

Sequence:	G7PX72
Domain Number -	Region: 166-200
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.0939
Family	LIM domain	0.021
Further Details:

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Cellular Component	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

External link(s)	G7PX72
Sequence length	213
Comment	(tr\|G7PX72\|G7PX72_MACFA) Uncharacterized protein {ECO:0000313\|EMBL:EHH59446.1} KW=Complete proteome; Reference proteome OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN=EGM_09563 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence	ASPLLGICIKCGLGIYGAQQACQAMGSLYHTDCFTCDSCGRRLRGKAFYNVGEKVYCQED FLYSGFQQTADKCSVCGHLIMEMILQALGKSYHPGCFRCSVCNECLDGVPFTVDVENNIY CVRDYHTVFAPKCASCARPILPAQGCETTIRVVSMDRDYHVACYHCEDCGLQLSGEEGRR CYPLAGHLLCRRCHLRRLQPGPVPSPTVHVTEL
Download sequence
Identical sequences	G7NM31 G7PX72 ENSMMUP00000007745 9544.ENSMMUP00000007745 ENSMMUP00000007745

SEARCH