SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G7Q0C2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G7Q0C2
Domain Number 1 Region: 34-125
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 4.58e-38
Family SCAN domain 0.0000409
Further Details:      
 
Domain Number 2 Region: 420-476
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.7e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 532-589
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.3e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 578-630
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.97e-18
Family Classic zinc finger, C2H2 0.0023
Further Details:      
 
Domain Number 5 Region: 382-433
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.72e-17
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 6 Region: 461-506
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000158
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 7 Region: 198-245
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000157
Family KRAB domain (Kruppel-associated box) 0.0037
Further Details:      
 
Domain Number 8 Region: 323-364
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000657
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G7Q0C2
Sequence length 632
Comment (tr|G7Q0C2|G7Q0C2_MACFA) Zinc finger protein FPM315 {ECO:0000313|EMBL:EHH60110.1} KW=Complete proteome; Reference proteome OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN=EGM_11406 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MASGPSPQEREGLLIVKLEEDCAWSQELPPPDPGPSPEASHLRFRRFRFQEAAGPREALS
RLQELCHGWLRPEMRTKEQILELLVLEQFLTILPQEIQSRVQELHPESGEEAVTLVEDMQ
RELGRLRQQVTNHGRETEVLLEEPLPLETARESPSFKLEPMETERSPGPRLQELLGPSPQ
RDPQAVKDRGNMEDKEMTGPQLPESLEDVAMYISQEEWGHQDPSKRALSRDTVQESYENV
DSLGEEKFENLEEGVPSVSSENTHPQVLLPDQARGEVPWSPELGRPRDRQQGDWAPPPEG
GMEQALAGASSGRELGQPKELQPKKLHLCPLCGKNFSNNSNLIRHQRIHAAERLCMGVDC
SEIFGGNPRFLSLHRAHLGEEAHKCLECGKCFSQNTHLTRHQRTHTGEKPYQCNICGKCF
SCNSNLHRHQRTHTGEKPYKCPECGEIFAHSSNLLRHQRIHTGERPYKCPECGKSFSRSS
HLVIHERTHERERLYPFSECGEAVSDSTPFLTNHGAHKAEKKLFECLTCGKSFRQGMHLT
RHQRTHTGEKPYKCTLCGENFSHRSNLIRHQRIHTGEKPYTCHECGDSFSHSSNRIRHLR
THTGERPYKCSECGESFSRSSRLMSHQRTHTG
Download sequence
Identical sequences G7Q0C2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]