SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G7Q0C4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G7Q0C4
Domain Number 1 Region: 198-254
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.34e-22
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 2 Region: 159-211
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.76e-20
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 3 Region: 239-291
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.97e-19
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 4 Region: 1-51
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-16
Family KRAB domain (Kruppel-associated box) 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G7Q0C4
Sequence length 296
Comment (tr|G7Q0C4|G7Q0C4_MACFA) Zinc finger protein 75A {ECO:0000313|EMBL:EHH60112.1, ECO:0000313|Ensembl:ENSMFAP00000030062} KW=Complete proteome; Reference proteome OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN=EGM_11408 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MYFSQEEWELLDPTQKALYNDVMQENYETVISLALFVLPKPKVISCLEQGEEPWVQVSPE
FKDSAGKSPTGLKLKNDTENHQPVSLSDLEIQASTDIISKKAKVKVPQKTAGKENHFDIH
RVGKWHQDFPVKKRKKLSTWKQELLKLMDRHKKDCAREKPFKCQECGKTFRVSSDLIKHQ
RIHTEEKPYKCQQCDKRFRWSSDLNKHLTTHQGIKPYKCSWCGKSFSQNTNLHTHQRTHT
GEKPFTCHECGKKFSQNSHLIKHRRTHTGEQPYTCSICRRNFSRRSSLLRHQKLHL
Download sequence
Identical sequences G7Q0C4 H9YZB7
XP_005591136.1.63531 XP_007981917.1.81039 XP_007981918.1.81039 XP_014980930.1.72884 XP_014980931.1.72884 ENSMMUP00000023628 ENSMMUP00000023628 9544.ENSMMUP00000023628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]