SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G7Q293 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G7Q293
Domain Number 1 Region: 22-187
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 1.96e-39
Family CRAL/TRIO domain 0.0022
Further Details:      
 
Domain Number 2 Region: 255-395
Classification Level Classification E-value
Superfamily PapD-like 1.39e-37
Family MSP-like 0.000000203
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G7Q293
Sequence length 455
Comment (tr|G7Q293|G7Q293_MACFA) Motile sperm domain-containing protein 2 {ECO:0000313|EMBL:EHH60722.1} KW=Complete proteome; Reference proteome OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN=EGM_18571 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MLDESFQWRKEISVNDLNESSIPRWLLEIGVIYLHGYDKEGNKLFWIRVKYHIKDQKTIS
DKKKLIAFWLERYAKRENGKPVTVMFDLSETGINSIDMDFVRFIINCFKVYYPKYLSKIV
IFDMPWLMNAAFKIVKTWLGPEAVSLLKFTSKNEVQDYVSVEYLPPHMGGTDPFKYSYPP
LVDDDFQTPLCENGPITSEDETSSKEDIESDGKETLETISNEEQTPLVKKSNPTESTSKA
EENEKVDSKMKAFKKPLSVFKGPLLHISPAEELYFGNTESGEKKTLMVLTNVTKNIVAFK
VRTTAPEKYRVKPSNSSCDPGASVDIVVSPHGGLTVSAQDRFLIMAAEMEQSSGTGPAEL
TQFWKEVPRNKVMEHRLRCHTVESSKPNTLMLKDSAFNMSDKTSEDICLQLSHLLESNRK
LEDQVQRCIWFQQLLLSLTMLLLAFVTSFFYLLYS
Download sequence
Identical sequences G7Q293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]