SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G7Q3G2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G7Q3G2
Domain Number 1 Region: 60-194
Classification Level Classification E-value
Superfamily NTF2-like 2.26e-46
Family NTF2-like 0.00000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G7Q3G2
Sequence length 197
Comment (tr|G7Q3G2|G7Q3G2_MACFA) Protein p15-2 {ECO:0000313|EMBL:EHH61141.1} KW=Complete proteome; Reference proteome OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN=EGM_19079 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MRKCRSHWSQGDRERHQRRSHYYEGPHTSHSSCGGRTREEVVTPPLPEHAAAGSPMAMSV
DFKTYVDQACRAAEEFVNIYYETMDKRRRALTRLYLDKATLIWNGNVVSGLDALNNFFDT
LPSSEFQVNMLDCQPVHEQATQSQTTVLVVTSGTVKFDGNKQHYFNQNFLLTAQSTPNNT
VWKIASDCFRFQDWSSS
Download sequence
Identical sequences F6XGA9 G7Q3G2
ENSMMUP00000017345 ENSMMUP00000017346 NP_001252636.1.72884 XP_005594399.1.63531 9544.ENSMMUP00000017345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]