SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G7VBA6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G7VBA6
Domain Number 1 Region: 87-193,385-739
Classification Level Classification E-value
Superfamily Subtilisin-like 8.16e-72
Family Subtilases 0.0011
Further Details:      
 
Weak hits

Sequence:  G7VBA6
Domain Number - Region: 840-873
Classification Level Classification E-value
Superfamily EF-hand 0.0834
Family Polcalcin 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G7VBA6
Sequence length 1258
Comment (tr|G7VBA6|G7VBA6_9CREN) Surface layer-associated STABLE protease, conjectural {ECO:0000313|EMBL:AET33603.1} KW=Complete proteome OX=1104324 OS=Pyrobaculum ferrireducens. GN=P186_2211 OC=Thermoproteaceae; Pyrobaculum.
Sequence
MNGKYLLTVLLITTVLAFAQTVKISGANPAILDTDTPILAKVKVSDVYTFASQWKTTPKI
ETARVLGKEVKVATVSINGLELRGRLDGASATLYYKGPASALKSIVESPHVESIFVKVMP
EIPPRDFFTDVASLLEKGGGTPQPTLPVMREIIGASRVEQLFGVNGTGVVIAIVDTGVDY
GHPDLQDALAWLIKTTDGKEIIASAIALVGGSLQYKTLRGQTSTLPLVQVASVEPLALDA
DESQVILLQSFTASGGYLQTSGQTFYVIDGPMVNIVNAACNYAVTGLVSKSGVYKFGMTY
LYIPWYGGVVKVGVVMYDPDQPGVYTAARVDLNSNCNFSDDPELRYFGNRLIVDSPTAPT
ISLGVAGGYFYDWGLWLDVYAKFYPGWDLSGNYLSIFYDFNSHGTACSSVAAGRGRAVYD
LGYLGQQRLRGIAPGAKVLGVKGLWWGMVEAGMMWAAGFDVNQDGQWYWTRQKRAHVISN
SWGISEFIYDYAAFGYDFESAVINALAARGFLDRNYPGIVVVHAGGNGGYGFGTITSPGA
AAGAITVGAATSGHFWLALGTPFYGFRWGDIISWSLRGPTVAGYVKPDVVNIGAFGIAAY
PVGWGRYYYGIPEDWDIFGGTSQATPLTAGVVALVLSAVADKVDPAAVDPFLVRQFIAST
AIDIGYTPFTAGHGFVNATAAVIAARAYYGLPAPRSPVALFQTNSVVNLGDSWSFQWRVN
IPLYFGYLMNNVLTPQWAAYLQTGVPQPSLGMTSMYLTANPGGQAVGTLTVTAVGSRLAV
SASVQTLAPIYRKTTTLNIPVGTLGGYFTMQLLGSDEDVLRQADLVVFRIAYSFSAFDPE
FDYVNNVRPVLWVFGWTDLNGDGRIAVNELTWINYGYQRGTAVEVPVSKLSAKLGPGQRL
VLRIDIRPVTAPYPASVPVTLEVVAYKRVPAPDASITPSAYTLAPGQRYTFVVRVTPPSN
AAPTVYERLIVLNVNGTSYVVPLSYVVRAVVPVNTAYVLTSGRSDSWYSASEVRGGNDWA
WRYESGDWRVYYVSTPTLARGLYVDFRWRCINTSLILYTVTDSGFFAGYFWNQGVTYHRY
LGSGKFNWTGVGGQAKVLALPAASFAVPIVAPGLLYQTMSASYPVAGARSFAIVARTSLY
GGCGTSEAIGGVVRPFIETGDSPITITTSPYVRVVLSRPPISYLFALKSASVLGGGLVVP
MATVGGDLRFSMYFIRLPVFVDYVALLYSPENAVWSRISGDKFYRYPWYAVEGVSVIS
Download sequence
Identical sequences G7VBA6
gi|374327655|ref|YP_005085855.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]