SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G7YDC8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G7YDC8
Domain Number 1 Region: 753-888
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000029
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 2 Region: 364-400
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000952
Family EGF-type module 0.0067
Further Details:      
 
Domain Number 3 Region: 563-742
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000132
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 4 Region: 517-555
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000363
Family EGF-type module 0.012
Further Details:      
 
Domain Number 5 Region: 438-476
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000023
Family EGF-type module 0.0071
Further Details:      
 
Weak hits

Sequence:  G7YDC8
Domain Number - Region: 323-349
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0592
Family EGF-type module 0.056
Further Details:      
 
Domain Number - Region: 490-522
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0762
Family EGF-type module 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G7YDC8
Sequence length 993
Comment (tr|G7YDC8|G7YDC8_CLOSI) Neurogenic locus notch homolog protein 3 {ECO:0000313|EMBL:GAA50962.1} KW=Complete proteome; Reference proteome OX=79923 OS=Clonorchis sinensis (Chinese liver fluke). GN=CLF_105313 OC=Opisthorchiida; Opisthorchiata; Opisthorchiidae; Clonorchis.
Sequence
MAELNHMVASAHCSVAQSIMYLSNTHAVFCLIVYTTTIGLSTEDRRWNKYVNPYHNKTEE
YASSHNGIWFRGGNIYNQPYRPSDFTSTHPVHRAIRRLELLRKHTKQRGFANRMQMDTQQ
TQDSLLWHPEARNRGVGQDSVVPFSPYQPLPMIGDVTRDEDVGQSKRMIWNEEGQFWGYG
QPAETNLASDEQFIWPYSTGASVYDDGLCTPPFCIPANCDENEGQQCRKRQATMTSCLGT
DCASKCPGEQQCPAVCRITATGPTCVIFDAATCENQYALQCVHGCARESNSSAPLKCICD
PWRPNATSCISAEMDVFECPLGCSGRGRCDRTTKQCHCDPGFEGKGCEFKHACPTGLTGP
NCTMDIDECLSGAAGCQHLCVNTYGSFRCECHDGYQIDPRDPSRCVASETCETRCTRGQG
YCDEQRRCQCYSGFEGEWCEQDVDECRAGTHSCEQVCVNTQGAYECRCNQGYEPDPHYPN
RCRPVGCHPPCVRGQGTCSEAGRCVCTPGFTGIDCAEDEDECATGRHKCMQRCVNTYGSY
LCQCDPGYRTDPSDMTRCLPEACDPQCYDDTGLCYGRSCIHGECRVDYDHQNGTHRARCA
CHPGYTGVRCEQDIDECAPDALVRHQCDQRCENIPGSYECSCNTGYILQPDKRTCVREPE
RCGAGCQNGGICMPDGRCECPVRFDGPRCEFEVNVCQKVKACEHYCITEQDGSFRCVCRP
GYQLSEDGRSCRPSDACAEGCENGGHCFQGRCICKAGFEGPRCELDKDECKLSVAVHGCQ
FDCINTYGSYECICPPGHKRLSDRRTCVRIQETGDCDPPCRNGGICRDGNRCECLRGYRG
PDCAEDINECEEYQPCDPQFAQCVDRPGGFDCICRPGYRLMVDGRHCMEEERAERTPHLA
YRGRGQKGVVVASPYPGASPVSSGQPLTEVVRTKRRRRQPREPQTQVFSSNFRRRVYRNT
PIVYSHQERKGDPAPLRRSISPLTYFKVYRTRY
Download sequence
Identical sequences G7YDC8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]