SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G7YRI6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G7YRI6
Domain Number 1 Region: 12-274
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.84e-58
Family Ankyrin repeat 0.00014
Further Details:      
 
Domain Number 2 Region: 239-372
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000134
Family Ankyrin repeat 0.0075
Further Details:      
 
Domain Number 3 Region: 426-468
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000785
Family SOCS box-like 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G7YRI6
Sequence length 510
Comment (tr|G7YRI6|G7YRI6_CLOSI) Putative ankyrin repeat protein RF_0381 {ECO:0000313|EMBL:GAA55565.1} KW=Complete proteome; Reference proteome OX=79923 OS=Clonorchis sinensis (Chinese liver fluke). GN=CLF_108341 OC=Opisthorchiida; Opisthorchiata; Opisthorchiidae; Clonorchis.
Sequence
MTTSGTTIPGLAFYDALVNNSLVELKRCVELHKIDLNARLSHVRKRNHTDLCPVHLVAYK
GYFAMLHYLIQNGINVHQPTLTLQRRAVHFAALRHQVSCLQMLLNAGAQLDARDTFGNTP
LHYAAEDGDGALLSLLLNNGASVDSQDITNKTPLMKAARSGKLWAVRRLIAFGANVNVKD
RNDETALHFACRQGSTEITSMLIKAGARLNAQNQIGLTPLMEAVSYNQREAVSLMVKQRG
VDLYKRDFCTGDTALHIAVKKNYIHMVEILLQAGNWYIEYNYNNLGESFVHDVIAYNRLD
LLRLFLAYNYDFDRPAKRLPASILGAIVPEASSSNTVGAGGSFSNTCEKSPFQLALERGH
LDLARILADVGCYRIKLPITSGPFTLPLSLYTTSALQSNNSTPSWPNVASLSNSSSLARR
YSGLLEVKSLKKWCRRAIRQLLGFRLIDALPQLPLPIALKDFLLLRDIDWYVCWSTAMAH
RGPSNTSELAIIVPPRYTHSPTQRSNSTRT
Download sequence
Identical sequences G7YRI6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]