SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G7ZH47 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G7ZH47
Domain Number 1 Region: 61-144
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000523
Family Collagen-binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G7ZH47
Sequence length 221
Comment (tr|G7ZH47|G7ZH47_AZOL4) Uncharacterized protein {ECO:0000313|EMBL:CBS90734.1} KW=Complete proteome; Reference proteome OX=862719 OS=Azospirillum lipoferum (strain 4B). GN=AZOLI_p40349 OC=Rhodospirillaceae; Azospirillum.
Sequence
MVSSLNASIKNAVDAIKKSQSNQAVGDVQEFSKTVKKSALTTTAGATDIGVLAKNATRLN
VASTLSANDKVDFYKFKVTTKGEMTMGQVGDDGVRVQLMNRLGRVLADSDPKSGDDYDSF
KKLQAGNLTVDKGDYTLRVTRDKGQPDKDPKNYAMQLVMGNYSKDYDTVAKAPAKGDTGL
ALTTGQQATLDGLNSAIGSLNSIPTGQTGTQKLMGSFNLFA
Download sequence
Identical sequences G7ZH47
WP_014189585.1.44154 gi|375006529|ref|YP_004975313.1| gi|375006529|ref|YP_004975313.1|NC_016587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]