SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G8F412 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G8F412
Domain Number 1 Region: 1-90
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.42e-17
Family THAP domain 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G8F412
Sequence length 902
Comment (tr|G8F412|G8F412_MACFA) THAP domain-containing protein 9 {ECO:0000313|EMBL:EHH62026.1} KW=Complete proteome; Reference proteome OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN=EGM_20188 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MTRSCSAVGCSTRDTVLSRERGLSFHQFPTDTIQRSKWIRAVNRVDPRSKKIWIPGPGAI
LCSKHFQESDFESYGIRRKLKKGAVPSVSLYKIPQGVHLKGKARQKILKQPLPDNSQEVA
TEDHNYSLKTPLMIGAEKLAEVQQMLQVSKKRLISVKNYRMIKKRKGLRLIDALVEEKLL
SEETECLLRAQFSDFKWELYNWRETDEYTTEMKQFACTLYLCSSKVYDYVRKILKLPHSS
ILRTWLSKCQPSPGFNSNIFSFLQRRVENGDQLYQYCSLLIKSIPLKQQLHWDPSSHSLQ
GFMDFGLGKLDADETPLASETVLLMAVGIFGHWRTPLGYFFVNRASGYLQAQLLRLTIGK
LSDIGITVLAVTSDATAHSVQMAKALGIHIDGDDMKCTFQHPSSSSQQIAYFFDSCHLLR
LIRNAFQNFQSIQFINGIAHWQHLVELVALEEQELSNMERIPSTLANLKNHVLKVNCAAQ
LFSESVASALEYLLSLDLPPFQNCIGTIHFLRLINNLFDIFNSRNCYGKGLKGPLLPETY
GKINHVLIEAKTIFVTLSDTSNNQIIKGKQKLGFLGFLLNAESLKWLYQNYVFPKVMPFP
YLLTYKFSHDHLELFLNMLRQVLVTSSSPTCMAFQKAYHNLETRYKFQDEVFLSKVSIFD
ISVARRKDLALWTVQRQYGVSVTKTLFHEEGICQDWSNCSLSEALLDLSDHRRNLICYAG
YVANKLSALLTCEDCITALYASDLKASKIGSLLFVKKKNGLHFPSEGLCRVINICERVVR
THSRMAIFELVPKQRELYLQQKILCELSGHIYLFVDLNKHLFDGEVCAINHFVKLLKDII
ICFLNIRAKNVAQNPLKQSERTDMKTLSRKHWSSLQDYKCSSFANTSSKFRHLLSNDGYP
FK
Download sequence
Identical sequences F6WS43 G8F412
ENSMMUP00000011157 9544.ENSMMUP00000011157 XP_001086766.1.72884 XP_005554975.1.63531 ENSMMUP00000011157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]