SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G8F568 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G8F568
Domain Number 1 Region: 3-46,95-197
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 3.34e-18
Family Acetyl xylan esterase-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G8F568
Sequence length 207
Comment (tr|G8F568|G8F568_MACFA) Acyl-CoA thioesterase 6 {ECO:0000313|Ensembl:ENSMFAP00000031492} KW=Complete proteome; Reference proteome OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN=EGM_20757 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MLQHPEVKGPSIGLLGFSKGGDLCLSMASFLKGITATVLINACVANTITPLHYKDMIIPK
LVDDLGKVKITKSGFLTFMDTWSNPLEERNHQSLIPLEKAQGPFLFIVGMDDQNWKSEFY
AQIASERLQAHGKERPQIICYPETGHCIDPPYFPPSRASVHAVLGEAVFYGGEPKAHSKA
QVDAWQQIQTFFHKHLNGKKCVKHSKI
Download sequence
Identical sequences A0A2K6API3 F7AN72 G8F568
9544.ENSMMUP00000032741 ENSMMUP00000032741 ENSMMUP00000032741 NP_001165423.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]