SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G8LS86 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G8LS86
Domain Number 1 Region: 390-739
Classification Level Classification E-value
Superfamily L domain-like 1.43e-60
Family Internalin LRR domain 0.0000585
Further Details:      
 
Domain Number 2 Region: 206-342
Classification Level Classification E-value
Superfamily Outer arm dynein light chain 1 1.83e-23
Family Outer arm dynein light chain 1 0.0055
Further Details:      
 
Domain Number 3 Region: 895-956
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 8.24e-17
Family Invasin/intimin cell-adhesion fragments 0.0092
Further Details:      
 
Weak hits

Sequence:  G8LS86
Domain Number - Region: 94-161
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0031
Family Fibronectin type III 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G8LS86
Sequence length 1252
Comment (tr|G8LS86|G8LS86_CLOCD) Leucine-rich repeat (LRR) protein {ECO:0000313|EMBL:AEV67147.1} KW=Complete proteome; Reference proteome OX=720554 OS=Clostridium clariflavum (strain DSM 19732 / NBRC 101661 / EBR45). GN=Clocl_0418 OC=Ruminiclostridium.
Sequence
MGNFKRLLCLVVTVFFTFHFYVTSVAAAHATISDNILEPFSIDETEIKLQLQSDIFDFST
QSENTLLSTATYHNFSVSDTSNLPKLNIKKGPQVSSTRIELTFAPFYGAKNYDILFSKDG
NFENPDYKQTSDHTSCNFSLYNFVHNSKWYVYVLAYNSDGEIIAHSDVKTFLVPEDYPIP
FEPFLAKVIRKAINKPNGEIYKSDVEKIKVLDASNQRLTSLANISFLTNLEELYVQDNLI
RNFPFDEFAKMEKLAKVDLSNNLLGVSSYGYFDFSKVNIAVLNLSNNCIKSINFHQENSS
IKELNLSSNRISDISSFNKLTNLKSLYLKNNPIEDFSPISEYYDDLVNKDFVLSSSAPEG
EGTTEPTSSESPITFPDKNLEKAIRSSIRRSSGSIYPSDLADVYLLDISDKNIKNLEGIQ
YFSNLRSLYMSDNSITDIKPLESLKYLKDLYLNGNKIEDLTPLEKLENLNILDLSNCDIS
DITVLSKLTKLNDLYLDNNNISDITPLKNLKNLCVLWIQNNQLTDISALSKHDNLVMLTL
YNNKIKDISALKNSVYLQDLILTLNPISSIDALGNLVNLGFLSLSSISVSNFDILKNLKK
LYMLDLYNNNISDISFLKDLKKLTILDISNNKNIKDYSAVEELIDLSNLNISDNSIENIN
FLSNLTSLKYLYASGNSIKDLTPLKDLYNLTLLDLANNKISKIESLSKLNKLTTLYLAFN
NIYAFSPVSTFYDKLRNKDFNLNATETTGIKLNRESITITKGNKPKKLTYAEFASFLVKT
FDLKDNPNPVPDLPLVSKDDPYYNDIVIALKNNALYPIDPANFNPTEYVTRRYYASNILS
LLNYNLQSPFSSYIKDLEPKAENIPAIIVVAAGLMTLNEDNLFCPEEVMLLDIDAQLIPI
VSPTNAVNKRVIWSSSNEKVATVDSTGFVKGISTGTAEITATTLDGKYSAKCTVTVLPSD
NEDEEPQPTPSPTSNPGSGNSGGKPGGGSGGGGSSGGGGSSGGSSGGGGGSSGGGSGGGS
AGGPSSGDVPNSPKPTPTITSNPVNTNTPTSTPTPTNTPEVTPTPTPISIKFTDVENHWA
KETIEMLASKGIISGYPDGTFKPDSNMTRAEVSVVLAKAIGLDPAESNLTFKDSKDIPKW
AEGFIQAIVDKGIIKGYDDGEFKPNRVLTRKEMVVMAVNAFNIEGIEIELPFADSDAIPN
WAKTSVSKAFSSNIVKGYADNTFKPDKEVTRAEVCTIIAKCLELIAHSNTGS
Download sequence
Identical sequences G8LS86
WP_014253779.1.34793 gi|374294880|ref|YP_005045071.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]