SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G8LSC8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G8LSC8
Domain Number 1 Region: 431-634,665-987
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 3.74e-56
Family Glycosyltransferase family 36 C-terminal domain 0.00068
Further Details:      
 
Domain Number 2 Region: 204-408
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.0000534
Family Glycosyltransferase family 36 N-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G8LSC8
Sequence length 989
Comment (tr|G8LSC8|G8LSC8_CLOCD) Cellobiose phosphorylase {ECO:0000313|EMBL:AEV67189.1} KW=Complete proteome; Reference proteome OX=720554 OS=Clostridium clariflavum (strain DSM 19732 / NBRC 101661 / EBR45). GN=Clocl_0465 OC=Ruminiclostridium.
Sequence
MLEKLVARGVKTTPEAVLRNSFKSLNENSKVDAMFTDTTFKSVIGVSGLPFKVPAVLQLL
KSRDVSEYLLTQAENGASVMVEIESNGSVSVYKSANGEIQKIEVPAEIKQKIETLLSNVS
NWAGHLNDKGEHVIDLRTPAPGPHFYVNLLMGNRIGFDHALQTTPKSVVDRLGRGAFRSH
AATQVLATRWDMRQEEGGFPANRQFYLVENYKKIFYSADPNDCNIESATCTHSQNHTIIE
YRTKCGLSIKRTIFILPQIEGLPLATEVQRIEVTNLTDKERNIKLVYTGMFGTPATHAIF
EDVLYTNVIMQSSIMRKDDGSIIAITPDYYPEPFREDMRFHTMMVRNGDSLEFPKEFCAN
YNEFVGNGTLEDPENISKLSNHFYRKGPGFFALASEVKLGAGKTAVFDNFTGLSSNKVNP
SFNEEVFKKEVSNLVDKFSNAGEVEKALEQVIKFAERYSSFMQLKTEDEEFNTYFNKNLP
FQVLYQTFVSRSFCQTQKGYREIGFREIQDLYASMYYFVSMGEGDFVKQLLKEWCSMIFE
FGYAYHNFFWVGKEPGKWSDDALWFVQAVYRYISLTGDIKFLDEEVEVAGTNPAAKRPVY
ETIKALIKYSAQISIGKHGLPLLDNADWNDCLKLDNDFIDGITKEKLYKEQIAKSGNSDE
PFESDYSESVMNAFLLKVAIDEMIQLSGEKGDAEYKAQLEKMSSKLFDNIQKHAWKEDFF
ARVLFNRFKDGKFTYLGAKGDNLSADPEIDGSYFLNSFSWSILSDSADEEQIAIMLDRVE
KYLKTPYGLKLVTPTDLGRVANDTATGHYFPGDRENGGVFKHATMMATAAMFKAAKTVKS
KELAARLANMAYWMVDLVAPFRTMSNPFEKAGNPRFCTQYNNSETGENIGPMLSGTSTWL
TLTLMSAFGVEYTTQGLIIDPIIREGEQTTSYSVNTGKAVYNITIKKPKGFYRSADGNVK
ISVDGKEIEGNLVPLFNDNKEHNVEVLFS
Download sequence
Identical sequences G8LSC8
gi|374294922|ref|YP_005045113.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]