SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G8LTJ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G8LTJ2
Domain Number 1 Region: 1-160
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.96e-17
Family SMI1/KNR4-like 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G8LTJ2
Sequence length 193
Comment (tr|G8LTJ2|G8LTJ2_CLOCD) Uncharacterized protein {ECO:0000313|EMBL:AEV69487.1} KW=Complete proteome; Reference proteome OX=720554 OS=Clostridium clariflavum (strain DSM 19732 / NBRC 101661 / EBR45). GN=Clocl_2941 OC=Ruminiclostridium.
Sequence
MKVKDFINEINSIYPDIDKNEVASDVLISEKEKSLGYKLPKSFKTFLKEFSNGIMLLDAE
PIGGVGEDDDSPCGSIFLASSQIKKSIINIIPTKETITPDKLIAFSLYDAMDSANNFWVF
ICDKEYTDNEYRVGLISQYTEDIVVVLDSFEEWLTVFWNANKDSDDAVSVFHSMYKTWEE
REDLLRPDWRNQD
Download sequence
Identical sequences G8LTJ2
gi|374297220|ref|YP_005047411.1| WP_014256036.1.34793 WP_014256036.1.85326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]