SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G8LU32 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G8LU32
Domain Number 1 Region: 25-245
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.27e-57
Family Glycosyl hydrolases family 16 0.000000394
Further Details:      
 
Domain Number 2 Region: 271-340
Classification Level Classification E-value
Superfamily Type I dockerin domain 1.86e-18
Family Type I dockerin domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G8LU32
Sequence length 341
Comment (tr|G8LU32|G8LU32_CLOCD) Beta-glucanase/beta-glucan synthetase {ECO:0000313|EMBL:AEV68420.1} KW=Complete proteome; Reference proteome OX=720554 OS=Clostridium clariflavum (strain DSM 19732 / NBRC 101661 / EBR45). GN=Clocl_1811 OC=Ruminiclostridium.
Sequence
MLSMYLKKLCIAILVSSLAIVHTPFNVPAAQVVNTYFEANFSNFDSNLFESANWPNGNPF
NCVWRPSQVSFSNGSMFLTLTRDDTGSGYPYKSGEYRTKAFFGYGYYEVKMKPAKNVGIV
SSFFTYTGPSDNNPWDEIDIEFLGKDTTMVQFNWYKNGVGGNEYYHRLGFDASQDFHTYG
FEWRPNYISYYVDGVKVYTGTRNIPSTPGKIMMNLWPGIGVDEWLGRFDGRTPITAEYKY
IRYYPDGFPTATQTPTATPTPYQPPTPTPQSVVIGDLNYDNRVDSIDYAYLKMYLLGQIY
DFPTPYDMQAADLNGDGKIDSIDYAYLKMYLLGFINKFPVQ
Download sequence
Identical sequences G8LU32
WP_014255006.1.34793 gi|374296153|ref|YP_005046344.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]