SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G8LUI9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G8LUI9
Domain Number 1 Region: 96-224
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 2.17e-31
Family Cellulose-binding domain family III 0.00016
Further Details:      
 
Domain Number 2 Region: 250-378
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 2.17e-31
Family Cellulose-binding domain family III 0.00016
Further Details:      
 
Domain Number 3 Region: 403-531
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 2.17e-31
Family Cellulose-binding domain family III 0.00016
Further Details:      
 
Domain Number 4 Region: 557-685
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 2.17e-31
Family Cellulose-binding domain family III 0.00016
Further Details:      
 
Domain Number 5 Region: 710-838
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 2.17e-31
Family Cellulose-binding domain family III 0.00016
Further Details:      
 
Domain Number 6 Region: 864-992
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 2.17e-31
Family Cellulose-binding domain family III 0.00016
Further Details:      
 
Domain Number 7 Region: 1017-1145
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 2.17e-31
Family Cellulose-binding domain family III 0.00016
Further Details:      
 
Domain Number 8 Region: 1168-1266
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 2.86e-30
Family Cellulose-binding domain family II 0.00014
Further Details:      
 
Domain Number 9 Region: 2-71
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 0.000000000249
Family Cellulose-binding domain family III 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G8LUI9
Sequence length 1267
Comment (tr|G8LUI9|G8LUI9_CLOCD) Cellobiohydrolase A (1,4-beta-cellobiosidase A) {ECO:0000313|EMBL:AEV70637.1} KW=Complete proteome; Reference proteome OX=720554 OS=Clostridium clariflavum (strain DSM 19732 / NBRC 101661 / EBR45). GN=Clocl_4211 OC=Ruminiclostridium.
Sequence
MTINKEKDGIIRILFLDDTLLNEYISKDGVFANITFKVSGTSTVTISKATFGDRSLKPVS
ATLTAGTVTVGGGTTQPTVPPTSQPTTGPIVTGFTAYVESVTASAGEQVVVPIKLANVPS
NGITTADMTITYDASKLEYVKGEAGSIVINPSINFAINKEKDGIIRILFLDDTLLNEYIS
KDGVFANITFKVSGTSTVTISKATFGDRSLKPVSATLTAGTVTVGGGTTQPTVPPTSQPT
TGPIVTGFTAYVESVTASAGEQVVVPIKLANVPSNGITTADMTITYDASKLEYVKGEAGS
IVINPSINFAINKEKDGIIRILFLDDTLLNEYISKDGVFANITFKVSGTSTVTISKATFG
DRSLKPVSATLTAGTVTVGGGTTQPTPTPTQPTTGPIVTGFTAYVESVTASAGEQVVVPI
KLANVPSNGITTADMTITYDASKLEYVKGEAGSIVINPSINFAINKEKDGIIRILFLDDT
LLNEYISKDGVFANITFKVSGTSTVTISKATFGDRSLKPVSATLTAGTVTVGGGTTQPTV
PPTSQPSTGPIVTGFTAYVESVTASAGEQVVVPIKLANVPSNGITTADMTITYDASKLEY
VKGEAGSIVINPSINFAINKEKDGIIRILFLDDTLLNEYISKDGVFANITFKVSGTSTVT
ISKATFGDRSLKPVSATLTAGTVTVGGGTTQPTPTPTQPTTGPIVTGFTAYVESVTASAG
EQVVVPIKLANVPSNGITTADMTITYDASKLEYVKGEAGSIVINPSINFAINKEKDGIIR
ILFLDDTLLNEYISKDGVFANITFKVSGTSTVTISKATFGDRSLKPVSATLTAGTVTVGG
GTTQPTVPPTSQPTTGPIVTGFTAYVESVTASAGEQVVVPIKLANVPSNGITTADMTITY
DASKLEYVKGEAGSIVINPSINFAINKEKDGIIRILFLDDTLLNEYISKDGVFANITFKV
SGTSTVTISKATFGDRSLKPVSATLTAGTVTVGGGTTQPTPTPTQPTTGPIVTGFTAYVE
SVTASAGEQVVVPIKLANVPSNGITTADMTITYDASKLEYVKGEAGSIVINPSINFAINK
EKDGIIRILFLDDTLLNEYISKDGVFANITFKVSGTSTVTISKATFGDRSLKPVSATLTA
GTVTVGGGTTQPTPTPTQPTTQPTTQPQTGNFSVKYSQNSWGTGATVSIEIKNNGSTAVN
GWTLSFDFPGNQKITNAWNCTYTQNGNAVSISNVDYNGTIPPGGSVVIGFNISYSGTNAE
PTNFIVK
Download sequence
Identical sequences G8LUI9
gi|374298370|ref|YP_005048561.1| WP_014257132.1.34793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]