SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G8LUL7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G8LUL7
Domain Number 1 Region: 10-113
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 7.06e-42
Family N-utilization substance G protein NusG, N-terminal domain 0.0000384
Further Details:      
 
Domain Number 2 Region: 122-177
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 1.38e-17
Family N-utilization substance G protein NusG, C-terminal domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G8LUL7
Sequence length 177
Comment (tr|G8LUL7|G8LUL7_CLOCD) Transcription termination/antitermination protein NusG {ECO:0000256|HAMAP-Rule:MF_00948, ECO:0000256|RuleBase:RU000538, ECO:0000256|SAAS:SAAS00126873} KW=Complete proteome; Reference proteome OX=720554 OS=Clostridium clariflavum (strain DSM 19732 / NBRC 101661 / EBR45). GN=Clocl_0650 OC=Ruminiclostridium.
Sequence
MQIDDTPEGAKWYVVHTYSGYENKVKANLEKIVENRGMQDYILDIVVPMEEQIEIKDGRK
KATLKKVFPGYVLVKMIMTDESWYVVRNTRGVTGFVGPGSKPVPLSDEEVRMMGVEEFMP
VLDYEVGDNVRVATGPLENFIGVVEEINLEKRKVRVSVSMFGRETPVELELFQIQKI
Download sequence
Identical sequences G8LUL7
gi|374295090|ref|YP_005045281.1| WP_014253988.1.34793 WP_014253988.1.85326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]