SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G8LUZ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G8LUZ6
Domain Number 1 Region: 51-684
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 3.51e-288
Family Cellulases catalytic domain 0.00000000000257
Further Details:      
 
Domain Number 2 Region: 732-1177
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 6.43e-159
Family Cellulases catalytic domain 0.0000000000126
Further Details:      
 
Domain Number 3 Region: 1391-1541
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 2.77e-55
Family Cellulose-binding domain family III 0.0000042
Further Details:      
 
Domain Number 4 Region: 1189-1341
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 1.36e-47
Family Cellulose-binding domain family III 0.00000481
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G8LUZ6
Sequence length 1541
Comment (tr|G8LUZ6|G8LUZ6_CLOCD) Endoglucanase {ECO:0000256|RuleBase:RU361166} KW=Complete proteome; Reference proteome OX=720554 OS=Clostridium clariflavum (strain DSM 19732 / NBRC 101661 / EBR45). GN=Clocl_3038 OC=Ruminiclostridium.
Sequence
MRIFEIPRRRNRFIALVTIFITFCIILVIYNKNAKNTFNNNPDKKNSPTSKSQNSTVYAD
RFLELFNDIQTKGYLSEEGIPYHSIETLLVEAPDYGHQTTSEAFSYMVWLGATYGKLTGD
WSYYKNAWDLTEKYIIPDAQKDQPGVDTYSPNSPAQYAPEGDTPNDYPITGAANAPTGID
PIAESLASAYGSKAIYQMHWLLDVDNFYKFGNHGDGTSRCSYINTYQRGPEESVWETVPH
PSWEDFKWGEGEKGGFLNLFGNFGQPAKQWRYTSASDADARQVQASYWAYLWAKEQGVEG
ELSEYTDKAAKMGDYLRYTFFDKYFRPIGVQDSSAAGTGYDSCHYLLSWYMSWGGDIGGA
WSWRIGSSHCHQGYQNLVAAYALSQEPALKPKAQGSQEDWQKSLKRQIELYQYLQSAEGA
IAGGVTNSWQGRYSKYPAGKSTFYDMAYDYQPVYHDPPSNNWFGFQAWSMERVMQFYYLS
GDPDIKNVCDKWVKWALSHTKLKNDGTYEIPSTLEWSGEPDTWRGKPTENSNLHCKVKDY
TQDVGVTASYAKALIFYAAATEKHTGTMHSEAKNMAKELLDRMWTNYRDDKGVAAPEERE
DYKRFFDEVYIPAGFSGTNGQGAQIKNGITFIDLRPDYKKDPDYAKVEEAVKNGKNPVMT
YHRFWSQASIAIANAMYHIYIEKEDGLITETSETENSTDINVSKDTDNIQSNGIYKYKYK
NNIPPQPQAKGPYNYGEALQKAIFFYDCQRSGKLSSTVLRLNWRGDSGLNDGKDVGLDLT
GGFYDAGDHVKFNLPMAYTTTMLCWAAYEYKDAFVNSGQFEPLLENIKWATDYFIKCHPE
PNVYYYQVGDGNADHAWWGPAEAMPMERPAYKLDKSSPGSAVSAQTAAALASASIIFKDI
DADYSKECLKHAKELFEFADSTKSDTGYTAAKGFYDSWSGFYDELSWAGVWLYMATNDKT
YLKKAEDYVNYWEKEPQSNAIKYTWSHCWDDVHYGAELLLAKLTNGNSKYKEAIEMHLDW
WTTGYNGNRIKYTPKGLAWLDQWGSLRYATTTAFLACVYSDWPGADKTKAKNYIKFAESQ
ANYALGSTGRSFVVGFGKNPPEHPHHRTAHGSWANSMSIPEKHRHVLYGALVGGPDSEDN
YRDEVSDYVCNEVACDYNAGFVGLLARMYNTYYGSPSETFNGIEEITEDEIFVEAGVNAS
GSNFIEIKAVINNKSAWPARVCENLSFNYYIDISEAINAGHSASDIKVSANYNQGAKVSE
LKPLKGNIYYVTVDFSGTKIFPGSQSDYKKEVQFRISAPEGTSYFDPQNDYSYKGLASNS
MIKTKHIPVYDKGTLVFGTEPDGKQSASDNTSNETAPLPTSNTALQNTSAPIPPTPVASN
SNSNKNTSGGNGKVVIQYTNGNATDSTNGINPRLRLVNNGNSSINLSDVKIRYYYTIDGE
KPQTFWCDWSSAGTSNVTGSFNKLTAAKNGADYYLEISFASGAGTLEPGSSVDIQARFSK
NDWTNYNQSNDYSFISTASDYTENSKITVYVSGKLVWGNEP
Download sequence
Identical sequences G8LUZ6
gi|374297306|ref|YP_005047497.1| WP_014256118.1.34793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]