SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G8LVJ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G8LVJ4
Domain Number 1 Region: 36-422
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.95e-67
Family beta-glycanases 0.00000687
Further Details:      
 
Domain Number 2 Region: 493-560
Classification Level Classification E-value
Superfamily Type I dockerin domain 5.79e-16
Family Type I dockerin domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G8LVJ4
Sequence length 561
Comment (tr|G8LVJ4|G8LVJ4_CLOCD) Endoglucanase {ECO:0000313|EMBL:AEV68583.1} KW=Complete proteome; Reference proteome OX=720554 OS=Clostridium clariflavum (strain DSM 19732 / NBRC 101661 / EBR45). GN=Clocl_1981 OC=Ruminiclostridium.
Sequence
MKKLIIFSVLLVLLVALLPTPGLQISAETTNVGAPDDDWLHVENGYIVDKYGNKVWLTGA
NWFGFNCREMMLLDSYHSDIIADIQIVADKGINVVRLPIATDLLYSWSKGIYPMSTDTSY
NNPILAGLNSFELFNLMLENFKKVGIKVILDVHSPETDNMGHNHPLWYKGEITEEIFKAA
WVWVANYYKNDDTIIGFDLKNEPHTNTGTLKFKSQSAIWDDSDHKNNWKRVAQETALEIL
KVHPNVLIFVEGVEMYPKDGKWDDESFDTSPWTGTNDYYGNWWGGNLRGVRDYPIDLGKY
QSQLVYSPHDYGPIVYEQSWFAGDFVTASDEEAKKILYEQCWRDNWAYIMEEGISPLLLG
EWGGITEGNHKLLDLNLKYLRCIRDFILENKYKLHHTFWCINIDSADTGGLFTRDEGTPF
PGGRDLKWNDNKYDNYLLPVLWKNEEGKFQGLDHEIPLGKNGVPLPKGTSPVTPTKTPVT
PTPTSTPTPTPSNVIKGDINGDGEINSIDYAILKSYLLGLTKNLPAEDELAVADLNGDKE
INSIDYALLKMYLLGMIKDFS
Download sequence
Identical sequences G8LVJ4
WP_014255163.1.34793 WP_014255163.1.85326 gi|374296316|ref|YP_005046507.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]