SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G8LVX3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G8LVX3
Domain Number 1 Region: 26-166
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000000484
Family SMI1/KNR4-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G8LVX3
Sequence length 169
Comment (tr|G8LVX3|G8LVX3_CLOCD) Putative glucan synthasis protein {ECO:0000313|EMBL:AEV67540.1} KW=Complete proteome; Reference proteome OX=720554 OS=Clostridium clariflavum (strain DSM 19732 / NBRC 101661 / EBR45). GN=Clocl_0854 OC=Ruminiclostridium.
Sequence
MKDEKESNLKDWKDKISVMVLVKQEIQRLDKMGIWPHYLPEIAATEEQLASAEKYLGHSI
DKDYREFLMCANGWKGFLHTIDLFGTGDLIGSSLMDYVLRNLDVMDDAAKLSETSGFLKE
ELLPIAATREDIDLFVITRETSSHPGIVIWFAGGEVEKFPNFKEFFSYD
Download sequence
Identical sequences G8LVX3
WP_014254165.1.34793 gi|374295273|ref|YP_005045464.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]