SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G8LW76 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G8LW76
Domain Number 1 Region: 9-132
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000903
Family SMI1/KNR4-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G8LW76
Sequence length 144
Comment (tr|G8LW76|G8LW76_CLOCD) Uncharacterized protein {ECO:0000313|EMBL:AEV69723.1} KW=Complete proteome; Reference proteome OX=720554 OS=Clostridium clariflavum (strain DSM 19732 / NBRC 101661 / EBR45). GN=Clocl_3207 OC=Ruminiclostridium.
Sequence
MSILDNVSNLYSVDVKKPPATEEEIIQLINFSPIDVPLEYLEIVREATEVEIKVKNEMYI
RIWSPTSCIEMNEVYFVQKYLPKSLAIGDDEGGALIYLHGKEGFGLYLCRFSDLDIDEAK
MIAPSLADLLLNNVGIDVVMSGYV
Download sequence
Identical sequences G8LW76
WP_014256257.1.34793 gi|374297456|ref|YP_005047647.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]