SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G8LWW6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G8LWW6
Domain Number 1 Region: 631-841
Classification Level Classification E-value
Superfamily SGNH hydrolase 1.24e-53
Family YxiM C-terminal domain-like 0.055
Further Details:      
 
Domain Number 2 Region: 180-380
Classification Level Classification E-value
Superfamily SGNH hydrolase 6.34e-44
Family YxiM C-terminal domain-like 0.000000569
Further Details:      
 
Domain Number 3 Region: 33-175
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.78e-39
Family YxiM N-terminal domain-like 0.000001
Further Details:      
 
Domain Number 4 Region: 480-602
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.7e-22
Family Family 6 carbohydrate binding module, CBM6 0.016
Further Details:      
 
Domain Number 5 Region: 402-467
Classification Level Classification E-value
Superfamily Type I dockerin domain 7.72e-17
Family Type I dockerin domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G8LWW6
Sequence length 843
Comment (tr|G8LWW6|G8LWW6_CLOCD) Lysophospholipase L1-like esterase {ECO:0000313|EMBL:AEV69827.1} KW=Complete proteome; Reference proteome OX=720554 OS=Clostridium clariflavum (strain DSM 19732 / NBRC 101661 / EBR45). GN=Clocl_3327 OC=Ruminiclostridium.
Sequence
MIRNVSKVLICILFILISLTCPTNVRIEAASVEYKFDFGAGYVEPGYIGVSASTAYNRTR
GYGFNTPENMRNVTASGTGVASDAVQFLTYGIKSNNTFNVDLPNGLYEIKVTLGNTSRAS
VAAEGVLQIINMTGNGAVDKFQIPITDGQLNILVTAGKEGTPFTLSALEIRKISDNPVTN
RTIWIGGDSTACNYYPLDTSEQCGWGQLLPKFVDTSLFQIRNMAASGQCARGFRDDGQFE
AIMKYIKPGDIFLLEFGINDTNPKNDTTEDQFKEIMTDMVVKVKSTGATMVLVTPQGRAT
DFNGNIHTAVNRWYRNTTIQVAREQNVRLCDLNVLSSAYFTSIGQEATLALYMPGDTLHP
NRAGATELARLVANDLKDLFTLTPTATAQPTYSPTPTGTAPQIMGDIDGDGSVTSIDFAL
LKKYLLSGIPDLSNVWYADVNSDGSVNSIDYAFIKAYLLGMIKEFPGSAQPPDNNLYTEI
YEAENAFIYHGIFENIHTGYSGSGYVNYDNEVGSYVEWYVNVPVTSWYSLTFKYANGTTA
NRPMSIMVNGNMAQSSMDFYPTASWTTWSESSIVLKLNQGQNVIRATGITTNGGPNVDYL
KISQTTGEPTNTPIPYVTPSPSAYPTTSNIPTIYLAGDSTVQSYNSSYYPQAGWGQVISD
YFTSDVKFVNKAIAGRSAKNFVEQGRLDEILNMIKEGDYLFIQFGHNDATISNPDRYAAP
YTTYKEYLAKFVDGARAKGAIPVLITPVARLNYKNNTYVNDFPDYCNAMKQVAAEKNCAI
IDLMTKCLNYYSTLDYNKVFTFYMVSSNGADYTHFTETGAREVAKLVAQGVKELNLPISK
YVK
Download sequence
Identical sequences G8LWW6
gi|374297560|ref|YP_005047751.1| WP_014256359.1.34793 WP_014256359.1.85326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]