SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G8LZX3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G8LZX3
Domain Number 1 Region: 133-414
Classification Level Classification E-value
Superfamily Pectin lyase-like 3.14e-42
Family Pectate transeliminase 0.0000832
Further Details:      
 
Domain Number 2 Region: 37-104
Classification Level Classification E-value
Superfamily Type I dockerin domain 1.77e-16
Family Type I dockerin domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G8LZX3
Sequence length 419
Comment (tr|G8LZX3|G8LZX3_CLOCD) Dockerin-like protein {ECO:0000313|EMBL:AEV69063.1} KW=Complete proteome; Reference proteome OX=720554 OS=Clostridium clariflavum (strain DSM 19732 / NBRC 101661 / EBR45). GN=Clocl_2488 OC=Ruminiclostridium.
Sequence
MSRKISVHISFLIALSMILTAFISMSTTVKANEIKDIVYGDLNGDGNADSIDYATLKMYL
VGIIQLSEKQLKASDLNLDGDVNSIDFAHFKRYLLGMIKSLPVEPVEATPTPVITTPTPT
SIIPTPTSFVKEGDIVLEPNGSMTLEQAIKSIQPGNTIYLKSGTYKYSKTIVIAEGNNGY
PGAYKKIASYGNDKPIIDFSAMAENSSNRGIVLAGNYWHIKNIAIHGAGDNGMLVAGHNN
IIEACNFMYNRDSGLQLSRYNSSYTTKDKWPSNNLIVDCYSAENMDSRAEDADGFAAKLT
CGEGNIFRNCKAEFNCDDGWDLYTKSDTGAIGVVIMENCEASNNGKYRSGRLTGGDGNGF
KLGDDTASVPHILKNCTANYNVKHGFTGNGNPARIVMENCSGTGNGGKLFDRLNNAIFR
Download sequence
Identical sequences G8LZX3
WP_014255631.1.34793 WP_014255631.1.85326 gi|374296796|ref|YP_005046987.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]