SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G8M2K2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G8M2K2
Domain Number 1 Region: 37-444
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.89e-75
Family beta-glycanases 0.0000012
Further Details:      
 
Domain Number 2 Region: 500-562
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000000000392
Family Type I dockerin domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G8M2K2
Sequence length 564
Comment (tr|G8M2K2|G8M2K2_CLOCD) Endoglucanase {ECO:0000313|EMBL:AEV70372.1} KW=Complete proteome; Reference proteome OX=720554 OS=Clostridium clariflavum (strain DSM 19732 / NBRC 101661 / EBR45). GN=Clocl_3932 OC=Ruminiclostridium.
Sequence
MKIGRRIIAFAAALMLAAYCLATTNKVEVQAVDTNNDDWLHCEGNKIVDMYGNEVWLTGA
NWFGFNCSENVFHGSWYDVKTILSSVADRGINFLRIPISTELLYSWMIGKPNKVSSVTAS
NNPPYHVVNPDFYDPETDGPKNSMEIFDIIIGYCKELGIKVMIDIHSPDANNSGHNYELW
YGKATDTAGVVTTQMWIDTLVWLVDKYKNDDTILAIDLKNEPHGKRGYTGNKCPSDIAKW
DDSKDENNWKYAAERCAKAILEVNPKLLIVIEGVEQYPKTEKGYTYDTPDIWGASPEESP
WYSAWWGGNLRGVKDYPIDLGPLNSQIVYSPHDYGPSVYAQPWFEKNFTTQTLLDDYWYD
TWAYIHDQNIAPLLIGEWGGHMDGGKNQKWMELLRDYIVENRIHHTFWCINPNSGDTGGL
LGNDWATWDEAKYGLLKKALWQTKDGKFIGLDHQIPLGKNGISLGEYYKTPQVPTPTTSK
TPTPTPVITPTPVITPTPSNYLLGDVNGDNEFNSVDYALLKMYLLGMGTPDYPLWKEAAD
MNKDGRIDSIDYALMKKTLLGIKD
Download sequence
Identical sequences G8M2K2
gi|374298105|ref|YP_005048296.1| WP_014256873.1.34793 WP_014256873.1.85326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]