SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G8M2S8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G8M2S8
Domain Number 1 Region: 125-275
Classification Level Classification E-value
Superfamily CYTH-like phosphatases 3.92e-26
Family CYTH domain 0.00012
Further Details:      
 
Domain Number 2 Region: 36-104
Classification Level Classification E-value
Superfamily Type I dockerin domain 1.7e-17
Family Type I dockerin domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G8M2S8
Sequence length 281
Comment (tr|G8M2S8|G8M2S8_CLOCD) Uncharacterized protein {ECO:0000313|EMBL:AEV68192.1} KW=Complete proteome; Reference proteome OX=720554 OS=Clostridium clariflavum (strain DSM 19732 / NBRC 101661 / EBR45). GN=Clocl_1556 OC=Ruminiclostridium.
Sequence
MRKSKLAISTLFLSFSLLFNGFSVMAEQMKPIVDNFILGDINGDGYIDSNDYGMLKLYLL
GFIKDFSYKHGFQAADVNSDGNVNSIDFAIFKRYLLGMITDFPQTPIPTPFATPKPPVTQ
AEGYEIERKFLIDPNKIPYDLDFLDKYEITQSYISFSPEIRLRNVDGTRFYLTVKANVDS
NGLIREERNFWMTEEEYNNLFKKIEGNVIYKARYQGLDEHRRIFAIDIFKGDLEGLAYYE
MEFPNEELANSYIPPSWVGKEVTSDKRYKNGSLAQFGIPKD
Download sequence
Identical sequences G8M2S8
WP_014254798.1.34793 gi|374295925|ref|YP_005046116.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]