SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G8M2V9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G8M2V9
Domain Number 1 Region: 2101-2277
Classification Level Classification E-value
Superfamily vWA-like 5.93e-33
Family Integrin A (or I) domain 0.0048
Further Details:      
 
Domain Number 2 Region: 2660-2830
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.05e-29
Family Clostridium neurotoxins, the second last domain 0.07
Further Details:      
 
Domain Number 3 Region: 3380-3515
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 3.93e-26
Family Intein (protein splicing domain) 0.013
Further Details:      
 
Domain Number 4 Region: 2845-3019
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.28e-22
Family Pentraxin (pentaxin) 0.054
Further Details:      
 
Domain Number 5 Region: 576-754
Classification Level Classification E-value
Superfamily Fibronectin type III 8.2e-22
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 6 Region: 345-458
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 0.000000000000105
Family Cellulose-binding domain family III 0.0033
Further Details:      
 
Domain Number 7 Region: 227-335
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000000000000405
Family Collagen-binding domain 0.0027
Further Details:      
 
Domain Number 8 Region: 508-575
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000000405
Family Type I dockerin domain 0.0022
Further Details:      
 
Domain Number 9 Region: 107-218
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000000000523
Family Collagen-binding domain 0.0047
Further Details:      
 
Domain Number 10 Region: 7-98
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000288
Family Collagen-binding domain 0.01
Further Details:      
 
Weak hits

Sequence:  G8M2V9
Domain Number - Region: 1905-1959
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.000101
Family TSP type-3 repeat 0.012
Further Details:      
 
Domain Number - Region: 899-980
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00157
Family Collagen-binding domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G8M2V9
Sequence length 3729
Comment (tr|G8M2V9|G8M2V9_CLOCD) Fibronectin type III domain-containing protein,CARDB domain-containing protein {ECO:0000313|EMBL:AEV68223.1} KW=Complete proteome; Reference proteome OX=720554 OS=Clostridium clariflavum (strain DSM 19732 / NBRC 101661 / EBR45). GN=Clocl_1587 OC=Ruminiclostridium.
Sequence
MPIGIGTVYGTFDIDDNNDWFVVYLKENTEYTIKLKGIASGNDYDLRVYDDELTQIGGSY
LTGNSDESITINIQNNGIYYLNVSRFSWSERVDNSYQLLIYQNTSHSDEYEENDSLNTAK
TISTNKDIYGTIGTNSDEDWYIVNVEKEGRLTIALLDIPVNCDYELSVYSEDLTYVGGSY
NYGNIDEKLSIMVERPNTYYIRIYSYKGCDPDNNYTLRASVSSPDIYEENDTISKAKNIK
VGCSVSATIDNPDDSDWYKFDVKDSMDCLIELQNIPYERDYDLYLFKESYCIAVSCFEGN
TDEFLNMQLTEGTYYIKVVPYSRCFSQTDNYTLSVKSSNGIVVSMPFIKVDSDSFIEVPL
MLDNIPEEGISCFNFAINYNKNILTYVGNSKGTLENINGDDLAIHEAEDGIRILYLDNSL
NNPIISSGTLVNLKFQINSNVTDGTCILGYNDNWSFASFTDSKFYIYSQVKFKAGMLAFG
EYNTFSAENIELSLNQPIMVTSYSEERLVGDIDGNGVFNSIDYAKLKALMLGYKIELPED
YEWAADVDGSGMINSIDIAYMKSYLLGKIKIFPKERPTAPSNLKVTSITSSGITLSWDES
TGLADIAYYEIYRDGVLCGESTTNSFQDSGLIINSNYIYEIIAVDIKGRKSIESNSIEVF
FEGVTDVEAPSAPRNFMVNWYTGVAVSLTWEAPEDATAIEGYEVYSGNTLLTFVKDTSVI
YTGLTCNTSYTLTVKAVDVLGNRSADSNEVVFTTGSDDYGNSHTNAVYLKLGEENKISGV
LESKTDEDCFLIKPPVNGVYRIKIINETTDKEIIGFLYNGFWGKSFSTWSTSIEKFYYIK
ELLFADNTYKLSVKYTSKILKDDGYSPKYNKYTILVEQVPPDWTVSEISSNATEIEIDTE
ISGKIRFGLFDSVSKSDYYKFKIPEDGYYIFEYSEGILNQICDSDNEFPSCKKEYTEEKL
KKYYFEKGDYYVRIYTTNTDISDYTFKIYKAKPDFRISSISPSVVLQSDTVELKAVVVNR
GHEYIDGKNTFRVGFLIDDVNIVYSDYCTQVIGEGKQIVLSAKADASLFNKLGNHTVRAF
IEKGTDFEEIDENNNTLVTEIFTDDYPDKREEARKISVNENIEGSIGFSGDYDWLTFTPE
IGGYYRIVASCDEKVSNKIELRLGNQDDNSLLLLGYLSAEENSMSILRKLEKNKTYYIRL
NGSIGNYKLSVDYAKPNLDITQVSPEFVFAGEKTTFSVTVKNIGDFYLEANSFRVGIKLD
DNEDIIWSDYNSNYLSVNSTISLNVEGCFYTVGEHTITVVIDYKNDLFNEGGTQGVSKLI
YAEYLDLKLKVSSITPTIVGLDNPVQFTVGVTNSGDKSLRLGKPLKVILKDKNDNVLAYG
ESSSFTKGSNSVLLDKGGIDGKGSVIFDKAGTAEVVAYIESCEDSSYQKEISVIKKTDLE
ILDISYSPESIKLNEQVTFKINIINKSSINLNANLFRIGLKLDDSEDIIWSSYNSSLSAN
RTTIFSVRGLISTTGEHIVTAFIDYNSNISKEKETVGFTKTIFIRHPDLQITNISPKDVF
IGDSTRFTVDVINNESVLHTGQLLKVVLKDKDKNILAYGEVDSFIDKGKSISLLLDKGGE
DGNGNVVFNEPGITEIEAYIDIENVIEESNEENNSYQTEINVIKKPDLKVLDITYSPVEI
KEGEKVVFKAKVKNCSDGMVIPSNLKVNFKIDTDTVISSATYNKEIYSNEIVEFTAETTW
TALLGEHNITAVVDEENLVIESNELNNSYTEKIIVGKKPDLIVTDISYSPEVPKTGDEII
FRATIKNIGEGSSPAGRVHRVGFKVDNSETLFWSDHFSWSIEPGESVTVDVSWGKNGSKW
LATEGQHIITAEVNDTRLMEEEEYVNNIYSESINIAGFSMLNLYDDYDNDGIDNATEIEL
GTNLMSSDTDGDGISDSEELRILSNPLLPDSDGDGILDGNELKLGLNLLVADENRIVSRT
CSTPDESVVVTAYGDLNINAKPFKVIVNDTFLNSLEGIIGSPVDISLGDCEIESASITFK
YSLDQLNGLDENKLKIYWVDTENGKLVPVESQTVDTVNKSVTCEVNHFSTYIMGVDLDTD
LSNVDIVFAIDRSGSMATNDPNLFRLKAIDRFVSDMDILKFRVGIVEYADTAQTKHTISD
NKTSLKSALKSINDSGNTNFGAGLYKSQELLRNSGNRNKVIVLLSDGQNNTGYSDNAVVD
ISKSIYSQGTNIYTISLGKSVDINLMERIAEAGGGRNFYIESANQIEPVYQQIMSMIGIG
RGYSDSYGRYYPGYVIMYDLSAIQHLVKVTDVQSKLSDGWTFYPRTGNEPKITLKERDYS
EITWTLTNAKYTTLKIVNCKKEETVQSSIIFEDGDYTTKSLDSDTLYRGELLYGSLVLDL
EYAYTKSNIEFGSPIKYAKYSLELLGYNNLKNANGVYSEEKDDKFVAALNDFIQAFKLEK
DYEESGNNEEVLYNWLKIAANNLKTYTEIKLSEDKRTLVNEYGEQLYTDFLNEFYELGIL
PEVVDNLLICVAPSKLLLNGDIIEKYILMTRENLIITRKMGRPSVKLISPTTLSIYNEID
GIVIEAEGENCAYIYAYVNGKNVAVQSGNSFSYKFIPKSEGLYKIYVEGRNAAENKGTAA
RSHTVEVLVRFTVASITRYYSLNFNGNSRVYLGNDSKLKPKSEITISMWVKPSSIQNQNA
TIISCEGLKSGYAIRQDGNNTNKYVFSYWNESGKEFKTEAVTLQPDCWQHIAVQKTIGGL
DSYLWFYVNGERIGIGAQYGDIGYDDNSELYLGTYAYSPGSRNFRGSLDDVAIWNRALSI
EEIQNVRNNGAEKDTYGLVKLLKNNSTSQATDVKNCKLDFDGSYRVNLGSVNRILPGKEM
TIAMWVRPLSHKTSNANIISCEGNEIGYSIEQNGNLTDYYVFKYWNGKTWKRTDPIRLNT
GSWQHIAVSISKDEEIKFILNGGEKINYSYGSVLWNSTNLYLGTDANSPGNGNFKGSMHQ
VGIWNRELTLEEIKKVMEDGPESKLYGLQQVCKSSTANFIKNEVEILEYIINDLSFEHLS
DITIVDGDTIRIKGGYLKNSDGSDYRYTLSFPINARLVDGLYYATDEEITDIIFKYMMEK
SRRGIYYKEYKLGGEEYIYSTACNPQYFNMVLDKGDIISKEDFINMMGPQWEFQYANTTV
NLEIIDVVHRFLDLGGMIPVFGTLLDGTNAILYFIEGDIVNACLSMLGTIELIQYGCAGL
KIAAKALKTTDKMMLGKNSLKVATDSIGLIKAGKANMLDDIASITRTQKGYEFVTTDGII
FKMIDDDIPAAAKSVVKSMSDSTDELMTCLKREPEALFELVEETKELDNTILYRLRDDTE
IQIFKSDLTPEQIICSTIGCFTGDTLVTTKEGLKRIDEVKTGDYVLSKDVKSGEIGYKKV
NYVYIKNTNKLVQLIVGTEEINTTSSHLFFTDTGWWKSAKSIKVGDRILTADGELKEVTG
TKVVELEEPVRIYNLNVEDYHTYFVGNSGLLVHNDCTAEMMYAGREAIEKARRMNIDDPK
ILSQIGEAAAKMVEDVKVMKQYIIVPENGFEAFVERKYIEIRKAALNDVADVAYNTGLPI
QDIIDMKNHLFLNTHKISVDGKPLETLYFKGDADIAYGWQVAQTRKLTDAEKEWFIQLRN
HELLEKKYMDEGMPYRDPSTWNATTKRFDENPVKNAHDKAALTAPNPRSFPGYDQSKDLL
KYFDDDIYY
Download sequence
Identical sequences G8M2V9
WP_014254828.1.34793 gi|374295956|ref|YP_005046147.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]