SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G8NP55 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G8NP55
Domain Number 1 Region: 278-445
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.36e-43
Family Histidine kinase 0.0014
Further Details:      
 
Domain Number 2 Region: 583-668
Classification Level Classification E-value
Superfamily CheY-like 2.42e-25
Family CheY-related 0.0043
Further Details:      
 
Domain Number 3 Region: 204-290
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 1.67e-19
Family Homodimeric domain of signal transducing histidine kinase 0.0017
Further Details:      
 
Domain Number 4 Region: 465-579
Classification Level Classification E-value
Superfamily CheY-like 1.42e-17
Family CheY-related 0.0041
Further Details:      
 
Domain Number 5 Region: 36-129
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.00000000000432
Family Histidine kinase 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G8NP55
Sequence length 709
Comment (tr|G8NP55|G8NP55_GRAMM) Histidine kinase {ECO:0000313|EMBL:AEU38254.1} KW=Complete proteome; Reference proteome OX=682795 OS=Granulicella mallensis (strain ATCC BAA-1857 / DSM 23137 / MP5ACTX8). GN=AciX8_3971 OC=Granulicella.
Sequence
MDETFKFPLLTIPLRHDRHVVQARQRARDVAALLGFEHQDQIRLATAASELARNAFRYAE
SGAVDFSVTNADPQVFVISVTDKGAGIPNLTEILDGRYVSKTGLGMGLIGTKRLMDHFHI
ASDSTGTRVECGKALPATAPAVNAASIKAISAKLAGGSAADPFDEIERQNQELLKTLAEL
KEKQDQLADLNQELEDTNRGVVALYAELEQHADDLRKVSDLKTSFLSNLSHEFRTPLNSI
SSLSRLLLGRTDGELSEEQEKQVTYIQHSASELSELVNDLLDLAKVEAGKIDVKPRHFEV
NDFFGALRGMLKPLLAGNSLELIFDAAADLPTLYTDEGKVSQILRNLIANALKFTRKGHI
RVTAEIEDGGWVAFRVADTGIGILPEDQERIFEEFTQIEGEMQSQVKGTGLGLPLSRRLA
ELLGGSLNVESESGQGSTFTARIPAHFGKTEIEPLAPLLNQEATGAPILFIEDNRETSFV
HQSSLKNSNYRTVFVANIPESRAAMKQMSPSLVVLDRLIDQKDCLYYIEELRSQGYSGPI
LVVSVVDDAKSAIEAGADAFLAKPVPPFSLLNVVRELIEGAPSKTILLVDDDEVTRYLVG
GALAKVGYRILEAHGGREALRLIKDEVPDAVVLDIAMPDMNGFEVLREIRKSLASKAIPV
IVHSSRELSNQDRKLLLDSFTFFYPKQAFSGEGGPRGLLQVLESTGIGL
Download sequence
Identical sequences G8NP55
WP_014267125.1.98070 gi|374312854|ref|YP_005059284.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]