SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G8NPB4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G8NPB4
Domain Number 1 Region: 66-164
Classification Level Classification E-value
Superfamily Sigma2 domain of RNA polymerase sigma factors 4.08e-32
Family Sigma2 domain of RNA polymerase sigma factors 0.00033
Further Details:      
 
Domain Number 2 Region: 172-254
Classification Level Classification E-value
Superfamily Sigma3 and sigma4 domains of RNA polymerase sigma factors 4.67e-16
Family Sigma4 domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G8NPB4
Sequence length 256
Comment (tr|G8NPB4|G8NPB4_GRAMM) RNA polymerase, sigma-24 subunit, ECF subfamily {ECO:0000313|EMBL:AEU34834.1} KW=Complete proteome; Reference proteome OX=682795 OS=Granulicella mallensis (strain ATCC BAA-1857 / DSM 23137 / MP5ACTX8). GN=AciX8_0482 OC=Granulicella.
Sequence
MSVVEAIVLPGETSRRRPSPFALGLQQAPGSAAEVKSAAGMPKAAAQPGTRAKLSTEQLE
ARQQQRAEDDELIRAAQKGDRAAFDTLVRRYDRSVLRLALHVLGNEQDAQDVHQDAFIKA
YRHLSNFRFECSFYTWLYRIVTNLCLDQLRRRKSRREDPSTVLDSSGDEIDLLANLQDGR
AMANPARELERKGMNEAIQSALAELTPRERTVFELKHYQGLKLRTIGEMLSTTEETAKNT
LFRATRKLRARLADVR
Download sequence
Identical sequences G8NPB4
gi|374309434|ref|YP_005055864.1| WP_014263718.1.98070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]