SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G8NUB5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G8NUB5
Domain Number 1 Region: 343-376,416-709,736-781
Classification Level Classification E-value
Superfamily Kelch motif 0.0000000157
Family Kelch motif 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G8NUB5
Sequence length 782
Comment (tr|G8NUB5|G8NUB5_GRAMM) Uncharacterized protein {ECO:0000313|EMBL:AEU35271.1} KW=Complete proteome; Reference proteome OX=682795 OS=Granulicella mallensis (strain ATCC BAA-1857 / DSM 23137 / MP5ACTX8). GN=AciX8_0922 OC=Granulicella.
Sequence
MRICNRLGVFTLFATALISVVGCGGKGGGGNSTTTPPPPATYTIGGTISGLTATGLVLQD
NGGDSLTVGANASSFTFATPITSGGAYSATVLTQPAGLNCTVTSGSGTASANVTTVSIVC
VQAYTIGGSVFGLSGTGLVLQDNGGNNLTVGASAKSYAFVFPNTIPSAGVPYSVTVLSDP
AGQSCTVAGPIGTAKASVTNVDVSCTANSSASYIISGTVTGLKGAGLILQDQAGVNDNDL
LPVDANGNFTFVDPIPAGGTYNVTVLTPPPGRHCVITNGTGAPIADVSNVSVVCLGEWTW
IGGNNIVGSNGEQPGVYGTLGTPDPANIPGGRQQELTWTDSTGKFWLFGGYGEDSTGVGF
GGQLNDLWRFDPALGTAGEWTWMGGSNVTPPSTSLGAAGEPGSYGTLGVTSPLNNPGGRE
QVASWLDASGSLWLFGGEGIDETGGTGQLNDLWKFDPTKGPTGEWTWLGGNSHVPFVFGG
QIGVYGAPGTPDPANIPGGRYGSMTWKDASGNFWLFGGQGTDVAGTQGYLNDLWQYAPST
GEWTWMGGSSSIGDSQGQSGTYGTQGTPDPTNIPGGRDAGVTWTDASGNFWLFGGLGIDA
AGNLAYLNDLWKYTPSAIGNTGQWTWMGGGTTAPQAYSGLSGVYGVQGTADPANIPGGRY
SAISWTDASGMFWLFSGSGYDSIGLQGSLNDLWKYTPSVTGDTGQWTWMGGSTIVGHAQG
QGQSGIYGMLGIAGSNNNPGGRFGSASWIDSTGNLWLFGGDGFDSTLTGMQGNLNDLWKY
QP
Download sequence
Identical sequences G8NUB5
WP_014264153.1.98070 gi|374309871|ref|YP_005056301.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]