SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G8NUZ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G8NUZ4
Domain Number 1 Region: 8-96
Classification Level Classification E-value
Superfamily Sigma2 domain of RNA polymerase sigma factors 2.35e-23
Family Sigma2 domain of RNA polymerase sigma factors 0.0011
Further Details:      
 
Domain Number 2 Region: 106-188
Classification Level Classification E-value
Superfamily Sigma3 and sigma4 domains of RNA polymerase sigma factors 0.00000000000000262
Family Sigma4 domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G8NUZ4
Sequence length 214
Comment (tr|G8NUZ4|G8NUZ4_GRAMM) RNA polymerase, sigma-24 subunit, ECF subfamily {ECO:0000313|EMBL:AEU38764.1} KW=Complete proteome; Reference proteome OX=682795 OS=Granulicella mallensis (strain ATCC BAA-1857 / DSM 23137 / MP5ACTX8). GN=AciX8_4492 OC=Granulicella.
Sequence
MRADLSSPENFEALVREHQGLVFRTLTRMTGGGPHVEDLAQEAFFRLYRALPDFRGDATI
STYLYRIVVNLAQDEWKRRRKERTHLASEPLSPEGEEESSGWIENFAGDSLASEHARTPE
QRLSDAEMQSAVDAELLALPEIERSVLVLYHQEECSYEGIAVALGLPINTVRTHLHRGRK
RLSERLRSRLAVQPHPKEGSSNGPATGAIMAGKV
Download sequence
Identical sequences G8NUZ4
WP_014267635.1.98070 gi|374313364|ref|YP_005059794.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]