SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G8NVD7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G8NVD7
Domain Number 1 Region: 134-193
Classification Level Classification E-value
Superfamily Sigma3 and sigma4 domains of RNA polymerase sigma factors 0.0000000579
Family Sigma4 domain 0.052
Further Details:      
 
Weak hits

Sequence:  G8NVD7
Domain Number - Region: 16-109
Classification Level Classification E-value
Superfamily Sigma2 domain of RNA polymerase sigma factors 0.011
Family Sigma2 domain of RNA polymerase sigma factors 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G8NVD7
Sequence length 204
Comment (tr|G8NVD7|G8NVD7_GRAMM) RNA polymerase sigma factor {ECO:0000313|EMBL:AEU36518.1} KW=Complete proteome; Reference proteome OX=682795 OS=Granulicella mallensis (strain ATCC BAA-1857 / DSM 23137 / MP5ACTX8). GN=AciX8_2199 OC=Granulicella.
Sequence
MSKGAPLSAALEGRGDVTSLLALWSRGDDSALEQLTPIIYDDLLRLAKAKLRREYGDCTL
EPTGLVHEAYLRLAGQSKVHAESRIHFYAIAANTMRRVLIEHARNHNAQKRGGGMRITLQ
TGMDIAQERPPDFIMLDEALGRLAQIDKRKSQTIELKYFGGLSTEEIGLHLGISVATVGR
ELRLGQAWIRREMSGALIDNKDEK
Download sequence
Identical sequences G8NVD7
gi|374311118|ref|YP_005057548.1| WP_014265396.1.98070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]