SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G8PJS7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G8PJS7
Domain Number 1 Region: 16-179
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.45e-53
Family NQO2-like 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G8PJS7
Sequence length 266
Comment (tr|G8PJS7|G8PJS7_PSEUV) NADH:ubiquinone oxidoreductase, 24 kDa subunit {ECO:0000313|EMBL:AEV37941.1} KW=Complete proteome; Reference proteome OX=911045 OS=Pseudovibrio sp. (strain FO-BEG1). GN=PSE_3435 OC=Rhodobacteraceae; Pseudovibrio.
Sequence
MSVRRLHHEQPESFEFSPENLEWAKKVIERYPEGRQASAVVPILWRAQEQVGWVTEPAIR
VISEMLDMPRIRVLEVATFYTMFQLQPVGKKAHIQVCGTTPCQLRGSEELIKVCKSKISE
TPHTLSEDGNFSWEEVECLGACVNAPMVQIFKDFYEDLDVEKFEKLLDDIAGGKPVLPGP
QGVDRIFAAPEGGPTTLLNIEDTTKGAPQEAVIVDGSDAASKHHAGAALNTGGAGYTGVP
RPAEAGVAEFVERHRKAQEAKAKGEG
Download sequence
Identical sequences G8PJS7
WP_014285951.1.37980 gi|374331779|ref|YP_005081963.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]