SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G8QI56 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G8QI56
Domain Number 1 Region: 121-301,337-525
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 7.19e-79
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.00014
Further Details:      
 
Domain Number 2 Region: 18-117
Classification Level Classification E-value
Superfamily Cytochrome c 6.45e-20
Family N-terminal (heme c) domain of cytochrome cd1-nitrite reductase 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G8QI56
Sequence length 532
Comment (tr|G8QI56|G8QI56_DECSP) Cytochrome c, mono-and diheme variants family {ECO:0000313|EMBL:AEV27459.1} KW=Complete proteome; Reference proteome OX=640081 OS=oryzae). GN=Dsui_3125 OC=Rhodocyclaceae; Azospira.
Sequence
MKTRVQAARRPSSLAFWLLSVPLGLGALWLASRPAHAADANAPALFQQHCAACHGADRLG
GMGPALLPENLERLRKAEALKTIREGRAATQMPAFKDQLSEADIAALADYAYAPVNPKPT
WTEKDIRASRIQHVDEKTLSPRPVFKADPMNLFVVVEGGDHHVSILDGDKLEPIHRFQSR
YALHGGPKFSPDGRFVYFASRDGWLTKFDLWNLKVVAEVRAGINTRNAAVSGDGKYVMAA
NYLPQDLVLFDADLNLIKVMEAKSADGKESSRVSAVYDAAPRKSFVAAMKDMPEVWEISY
DPEAHPIYDGLVHDYQYKEGVSVPGFLNPRRTRLTDPLDDFFFDQSYSEVMGTSREGKGQ
VVNLDARRKVSELQLSGMPHLGSGITWNWQGRTVMASTNLKEGKVTVIDMKDWKPVKDIV
TRGAGFFLRSHENSRYAFVDSMMSPAKDTLQVIDKDKLEIVKELKPVPGKTLAHIEFTKD
GRYALASLWEMDGALIIYDARTLEEVKRLPMKKPVGKYNVWNKITRSEGTSH
Download sequence
Identical sequences G8QI56
gi|372489735|ref|YP_005029300.1| WP_014238139.1.43509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]