SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G9HPV5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G9HPV5
Domain Number 1 Region: 86-179
Classification Level Classification E-value
Superfamily CAD & PB1 domains 1.37e-19
Family PB1 domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G9HPV5
Sequence length 190
Comment (tr|G9HPV5|G9HPV5_SOLLC) Auxin-responsive protein {ECO:0000256|RuleBase:RU004549} KW=Complete proteome; Reference proteome OX=4081 OS=Solanum lycopersicum (Tomato) (Lycopersicon esculentum). GN=101255303 OC=Solaneae; Solanum; Lycopersicon.
Sequence
MECVLAHEKDLNLKATELRLGLPGRTDEESDKEIVFHFKNNKRALPEDEDCESNSISDPK
TPPVAKTQIVGWPPVRANRKNSFPSKKAEAECGMYVKVSMDGAPYLRKIDLKLYKGYPEL
LKALEKMFKLSIGEYSEREGYKGSEFAPAYEDKDGDLMLVGDVPFEMFLSSCKRLRIMKG
SEARGLGCGV
Download sequence
Identical sequences G9HPV5
NP_001266256.1.44838 Solyc06g053840.2.1 Sopim06g053840.0.1 Solyc06g053840.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]