SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G9HPX0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G9HPX0
Domain Number 1 Region: 163-270
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000000137
Family PB1 domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G9HPX0
Sequence length 287
Comment (tr|G9HPX0|G9HPX0_SOLLC) Auxin-responsive protein {ECO:0000256|RuleBase:RU004549} KW=Complete proteome; Reference proteome OX=4081 OS=Solanum lycopersicum (Tomato) (Lycopersicon esculentum). GN=101055552 OC=Solaneae; Solanum; Lycopersicon.
Sequence
MEGYSQKWLMQRGEEINHGNSEEKKLELRLGPPNGDWSCGEKDESFYPFSYMSTTKGNNR
DNHAQNFSSFLQLQSTAQKQSQRVQESVCTKTADLQSTEKKKAFSQTATVQNSAQKRTAP
APVVGWPPIRSFRKNLASSSSVKSASETQNVVPNKSANKKPMEICQKGLFVKINMDGIPI
GRKVDLKAYDSYHKLSSAVDQLFRGLVAAQNDSSAGGNNEKKEDEEKAISGLLDGSGEYT
LVYEDNEGDRMLVGDVPWHMFVSTVKRLRVLKSSELSTLTRATKQLT
Download sequence
Identical sequences G9HPX0
Solyc03g121060.2.1 Sopim03g121060.0.1 Solyc03g121060.2.1 NP_001266088.1.44838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]