SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G9HPX2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G9HPX2
Domain Number 1 Region: 139-224
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000000000235
Family PB1 domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G9HPX2
Sequence length 227
Comment (tr|G9HPX2|G9HPX2_SOLLC) Auxin-responsive protein {ECO:0000256|RuleBase:RU004549} KW=Complete proteome; Reference proteome OX=4081 OS=Solanum lycopersicum (Tomato) (Lycopersicon esculentum). GN=101055553 OC=Solaneae; Solanum; Lycopersicon.
Sequence
MELELGLAISNCNHFPINAITSYRKNGFDDSFSDMKMKMKQKRCFEEAFHEDEGVVERKT
LSLFIWNGQPNEDDDNHGRNKKPFNATCHKDFEEESLKLLGWPPINTWRKKQFHHQGHAG
WITNDRNNNNNNNNNVIVGGRNSMYVKVKMEGVPIGRKVDLRLYHSYQLFTQNLLQMFAR
YQNSGKNSTRFTILYQDREGDWMLAGDVPWKTFVETVQRIEIQKNEK
Download sequence
Identical sequences G9HPX2
NP_001266091.1.44838 Solyc08g021820.2.1 Solyc08g021820.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]