SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G9K636 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G9K636
Domain Number 1 Region: 157-454
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.15e-75
Family Protein kinases, catalytic subunit 0.000055
Further Details:      
 
Domain Number 2 Region: 1-115
Classification Level Classification E-value
Superfamily DEATH domain 6.59e-39
Family DEATH domain, DD 0.00000179
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G9K636
Sequence length 460
Comment (tr|G9K636|G9K636_MUSPF) Interleukin-1 receptor-associated kinase 4 {ECO:0000313|EMBL:AES00361.1, ECO:0000313|Ensembl:ENSMPUP00000000358} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=IRAK4 OC=Mustelinae; Mustela.
Sequence
MNKPITSSTYVRCLNLGLIRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALL
QTGKSPTCELLFDWGTTNCTVGDLVDLLIQNEFFAAASLLLPDAVPKTVNILPSNEAVTV
QQKQLPLCGKDRTFVVPVQNLEQNFMPPDSSSPENPSLEGSDTRFHNFSFYELKNVTNNF
DERPISLGGNKMGEGGFGVVYKGFMNNKTVAVKKLAAMVDISTEELRQQFDQEIKVMAKC
QHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDDTPPLPWHMRCKIAQDAANGIS
FLHENHHIHRDIKSANILLDKDFTAKISDFGLARASEKFSQTVMTSRIVGTTAYMAPEAL
RGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYVDTKMND
TDPASIEAMYCIASQCLHEKKNKRPDIKKVQQLLQDMTAS
Download sequence
Identical sequences G9K636
XP_004765620.1.14098 XP_012918479.1.14098 ENSMPUP00000000358 ENSMPUP00000000358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]